Recombinant Cricetulus griseus Cathepsin D(H671_3g9701),partial


In Stock
Code CSB-EP006187DXU
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. G3I4W7
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006187DXU could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) CTSD.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006187DXU could indicate that this peptide derived from E.coli-expressed Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus) CTSD.
Storage Buffer Tris-based buffer,50% glycerol
Species Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence GPVSELLKNYLDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIHHKYNSGKSSTFVKNGTSFDIHYGSGSLSGYLSQDTVSVPCKSEQPGGLKVEKQIFGEAIKQPGITFIAAKFDGILGMGYPSISVNNVVPVFDNLMQQKLVEKNIFSFFLNRDPTGQPGGELMLGGIDSKYYEGELSYLNVTRKAYWQVHMDQLDVANGLTLCKGGCEAIVDTGTSLLVGPVDEVKELQKAIGAVPLIQGEYMIPCEKVSSLPSVTLKLGGKDYELSPSKYVLKVSQGGKTICLSGFMGMDIPPPSGPLWILGDVFIGTYYTVFDRDNNRVGFAKAATL
Research Area Others
Source E.coli
Gene Names CTSD
Expression Region 65-408aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 53.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

CTSD Antibodies

CTSD Antibodies for Cricetulus griseus

CTSD Proteins

CTSD Proteins for

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.