Recombinant Cupressus arizonica Pectate lyase 1

Code CSB-EP871029COADd1
Product Type Recombinant Protein
Size US$2466
Uniprot No. Q9SCG9
Relevance Has pectate lyase activity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Major pollen allergen Cup a 1 Allergen: Cup a 1
Species Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ADCVVGFGSSTMGGKGGEIYTVTSSEDNPVNPTPGTLRYGATREKALWIIFSQNMNIKLQMPLYVAGYKTIDGRGAVVHLGNGGPCLFMRKASHVILHGLHIHGCNTSVLGDVLVSESIGVEPVHAQDGDAITMRNVTNAWIDHNSLSDCSDGLIDVTLGSTGITISNNHFFNHHKVMLLGHDDTYDDDKSMKVTVAFNQFGPNAGQRMPRARYGLVHVANNNYDQWNIYAIGGSSNPTILSEGNSFTAPNESYKKEVTKRIGCETTSACANWVWRSTRDAFTNGAYFVSSGKAEDTNIYNSNEAFKVENGNAAPQLTQNAGVVA
Research Area Allergen
Source E.coli
Expression Region 22-367aa
Tag Info N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Mol. Weight 65.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has pectate lyase activity.
Protein Families Polysaccharide lyase 1 family, Amb a subfamily

Related Products

Antibodies

Antibodies for Hesperocyparis arizonica

Antibodies for Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)

Proteins

Proteins for Hesperocyparis arizonica (Arizona cypress) (Cupressus arizonica)

Proteins for Cupressus arizonica (Arizona cypress)

Proteins for Cupressus arizonica (Arizona cypress) (Callitropsis arizonica)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.