Recombinant Dog Major allergen Can f 1

Code CSB-EP519455DO
Product Type Recombinant Protein
Size US$2466
Uniprot No. O18873
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP519455DO could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) N/A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP519455DO could indicate that this peptide derived from E.coli-expressed Canis familiaris (Dog) (Canis lupus familiaris) N/A.
Storage Buffer Tris-based buffer,50% glycerol
Alias Allergen Dog 1 Allergen: Can f 1
Species Canis lupus familiaris (Dog) (Canis familiaris)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QDTPALGKDTVAVSGKWYLKAMTADQEVPEKPDSVTPMILKAQKGGNLEAKITMLTNGQCQNITVVLHKTSEPGKYTAYEGQRVVFIQPSPVRDHYILYCEGELHGRQIRMAKLLGRDPEQSQEALEDFREFSRAKGLNQEILELAQSETCSPGGQ
Research Area Others
Source E.coli
Protein Names Recommended name: Major allergen Can f 1 Alternative name(s): Allergen Dog 1 Allergen= Can f 1
Expression Region 19-174aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 33.3kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Secreted
Protein Families Calycin superfamily, Lipocalin family
Tissue Specificity Tongue epithelial tissue.
Database Links

KEGG: cfa:403830

STRING: 9615.ENSCAFP00000029242

UniGene: Cfa.3693

Related Products

Antibodies

Antibodies for Canis lupus familiaris (Dog) (Canis familiaris)

Proteins

Proteins for Canis lupus familiaris (Dog) (Canis familiaris)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.