Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Activity

Not Test

Target Names

SOD1

Uniprot No.

Q8WNN6

Research Area

Neuroscience

Species

Canis lupus familiaris (Dog) (Canis familiaris)

Source

E.coli

Expression Region

1-153aa(X53S)

Target Protein Sequence

MEMKAVCVLKGQGPVEGTIHFVQKGSGPVVVSGTITGLTEGEHGFHVHQFEDSTQGCTSAGPHFNPLSKKHGGPKDQERHVGDLGNVTAGKDGVAIVSIEDSLIALSGDYSIIGRTMVVHEKRDDLGKGDNEESTQTGNAGSRLACGVIGIAQ
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.8 kDa

Protein Length

Full Length

Tag Info

C-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Target Background

Function

Destroys radicals which are normally produced within the cells and which are toxic to biological systems.

Gene References into Functions

cold storage from 24 h prior to freezing resulted in a decrease in the superoxide dismutase (SOD) activity in the frozen-thawed sperm cells whereas the glucose peroxidase (GPX) activity and tROS levels were not affected. PMID: 23279517
a genomic insertion in intron 2 of SOD1 was found during routine diagnostic testing for canine degenerative myelopathy PMID: 27917507
The cyclic changes of SOD1 and GPx1 suggest that they may play important roles in endometrial physiology, probably in apoptosis and proliferation. PMID: 27114170
Variants within the SP110 nuclear body protein modify risk of canine degenerative myelopathy PMID: 27185954
The results of this study support the hypothesis that the cytoplasmic accumulation and aggregate formation of the mutant SOD1 protein PMID: 26162235
The SOD1:c.118G>A mutation could be a useful marker for breeding strategies intending to reduce the incidence of Degenerative myelopathy . PMID: 24390315
The frequency of the canine degenerative myelopathy-associated c.118G>A (p.E40K) mutation of SOD1 in healthy Pembroke Welsh Corgis in Japan using conventional and real time PCR methods is reported. PMID: 23328634
Our findings lend strong biochemical support to the toxic role of SOD1 in canine degenerative myelopathy and establish close parallels for the role mutant SOD1 plays in both canine and human disorders. PMID: 23707216
Muscle and peripheral nerve specimens at varying disease stages from Pembroke Welsh Corgis and Boxers are homozygous for the SOD1 mutation and have spinal cord histopathology consistent with degenerative myelopathy. PMID: 22542607
case report of c.52A > T missense mutation resulting in degenerative myelopathy PMID: 21848967
the continuous expression of mutant SOD1 causes the downregulation of GLT-1 by increasing the internalisation and degradation of the surface transporter, and the cytosolic tail of GLT-1 is required to targets the transporter to degradation PMID: 15466883

Hide All

Subcellular Location

Cytoplasm. Nucleus.

Protein Families

Cu-Zn superoxide dismutase family

Database Links

KEGG: cfa:403559

UniGene: Cfa.6360

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-EP819871DO
Abbreviation	Recombinant Dog SOD1 protein (X53S)
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Dog Superoxide dismutase [Cu-Zn] (SOD1)(X53S)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage