Recombinant Drosophila melanogaster GEO11329p1 (ITP)

In Stock
Code CSB-MP3350DLU
Abbreviation Recombinant Drosophila melanogaster ITP protein
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
ITP
Uniprot No.
Research Area
Neuroscience
Species
Drosophila melanogaster (Fruit fly)
Source
Mammalian cell
Expression Region
33-119aa
Target Protein Sequence
SNFFDLECKGIFNKTMFFRLDRICEDCYQLFRETSIHRLCKKDCFDSKWFGECLKVLLIPEEEISNLQHFLRVVNGSPISFNMGPQT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
38 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal hFc1-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Drosophila melanogaster GEO11329p1 (ITP) is produced in a mammalian cell expression system, which appears to ensure proper folding and post-translational modifications. The protein is expressed as the full length of its mature form, spanning amino acids 33 to 119, and carries a C-terminal hFc1 tag for easier detection and purification. The product achieves a purity of greater than 90%, as verified by SDS-PAGE analysis, making it suitable for various research applications.

GEO11329p1, also known as ITP, is a protein found in Drosophila melanogaster—the common fruit fly. It likely plays a crucial role in signaling pathways that are important for cellular communication and regulation. Scientists often study this protein for its involvement in key physiological processes, which has made it a significant focus in research related to insect biology and genetics.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant ITP protein may have a high probability of correct folding due to the mammalian cell expression system, which can support proper eukaryotic folding and potential post-translational modifications. However, the C-terminal hFc1 tag (a large fusion tag, typically ~25 kDa) is attached to the mature ITP domain (33-119aa, ~10 kDa), which could sterically hinder the protein's native structure, especially if the C-terminal region is involved in receptor binding or function. ITP is a small peptide hormone, and the tag may disrupt its conformational integrity or activity. The purity >90% indicates low contaminants, but does not guarantee correct folding or bioactivity. Without experimental validation (e.g., circular dichroism for secondary structure, receptor binding assays, or functional tests in Drosophila systems), the protein's folding status and bioactivity remain uncertain. Therefore, while the expression system is favorable, the tag and lack of validation mean it cannot be assumed to be fully functional.

1. Ion Transport Peptide (ITP) Functional Studies in Drosophila Research

This recombinant ITP protein can be used for functional studies only if correct folding and bioactivity are experimentally verified. The mammalian cell expression system may support proper folding, but the C-terminal hFc1 tag could interfere with receptor binding or signaling. If misfolded, results from binding assays or pathway studies may be invalid. It is recommended to validate activity using in vitro assays (e.g., with Drosophila receptors) or in vivo complementation tests before concluding. The tag simplifies detection but may not preserve native function.

2. Antibody Development and Validation

This recombinant ITP can serve as an immunogen for antibody generation, but the hFc1 tag may dominate the immune response, leading to antibodies that primarily recognize the tag rather than ITP-specific epitopes. If correctly folded, antibodies might recognize native ITP; if misfolded, they could target non-conformational epitopes, reducing utility for detecting endogenous ITP. For reliable antibodies, validate using tag-free ITP or confirm specificity with Drosophila tissue samples. The high purity is beneficial but does not ensure antigen quality.

3. Protein-Protein Interaction Studies

The hFc1-tagged ITP can be used in pull-down assays, but interactions detected may be tag-mediated or non-specific if the protein is misfolded. The Fc tag enables efficient capture on protein A/G beads, but biologically relevant partners might not bind correctly without native conformation. Validate folding first and include controls (e.g., tag-only protein or untagged ITP) to minimize artifacts. Mass spectrometry results should be confirmed with orthogonal methods.

4. ELISA-Based Quantitative Assays

This recombinant ITP can be used as a standard in ELISA assays, but the hFc1 tag may affect antibody recognition if the tag blocks epitopes. For accurate quantification of endogenous ITP, ensure that antibodies used in the assay are specific to native ITP and not influenced by the tag. Validate the assay with spike-recovery experiments using Drosophila samples to confirm reliability. The high purity supports consistency but does not guarantee immunological accuracy.

Final Recommendation & Action Plan

To ensure reliable outcomes, first validate the folding and bioactivity of the recombinant ITP protein using techniques such as circular dichroism to assess secondary structure, surface plasmon resonance or competitive binding assays to confirm receptor interaction, and functional assays in Drosophila models (e.g., ion transport tests). If possible, remove the hFc1 tag via proteolytic cleavage and re-purify the tag-free protein for critical applications. For antibody development, use the current protein but characterize antibodies thoroughly against tag-free ITP and endogenous samples. In all studies, include appropriate controls, such as tag-only proteins or wild-type ITP standards, to account for potential artifacts. Prioritize validation before functional or quantitative applications to avoid misleading data.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*