Recombinant Drosophila melanogaster General odorant-binding protein lush (lush)

Code CSB-EP517298DLU
Abbreviation Recombinant Drosophila melanogaster lush protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517298DLU could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP517298DLU could indicate that this peptide derived from E.coli-expressed Drosophila melanogaster (Fruit fly) lush.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
lush
Uniprot No.
Research Area
others
Alternative Names
lush; Obp76a; Obp76c; CG8807; General odorant-binding protein lush
Species
Drosophila melanogaster (Fruit fly)
Source
E.coli
Expression Region
30-153aa
Target Protein Sequence
MTMEQFLTSLDMIRSGCAPKFKLKTEDLDRLRVGDFNFPPSQDLMCYTKCVSLMAGTVNKKGEFNAPKALAQLPHLVPPEMMEMSRKSVEACRDTHKQFKESCERVYQTAKCFSENADGQFMWP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Odorant-binding protein required for olfactory behavior and for activity of pheromone-sensitive neurons. Binds to alcohols and mediates avoidance behavior to high concentrations of alcohols, the alcohol-binding possibly resulting in activation of receptors on T2B neurons, the activation of these receptors inhibiting these neurons. Acts in concert with Snmp and lush to capture cVA molecules on the surface of Or67d expressing olfactory dendrites and facilitate their transfer to the odorant-receptor Orco complex. Required for cVA response, probably by binding to VA. May act by serving as an adapter that bridges the presence of gaseous pheromone molecules, cVA, to activation of specific neuronal receptors expressed on T1 olfactory neurons, possibly via a specific conformational change induced by cVA that in turn activates T1 receptors. T1 neurons are excited by the pheromone VA, while T2 neurons are inhibited by alcohols. Also binds to phthalates.
Gene References into Functions
  1. the ligand-binding cavity of LUSH protein can accommodate a variety ligands and pheromones with strong binding interactions PMID: 23121132
  2. the alcohol binding in the LUSH protein is the consequence of three important factors: H-bonding, solvation, and the other noncovalent interaction. PMID: 20550105
  3. Structure of a specific alcohol-binding site defined by the odorant binding protein LUSH from Drosophila melanogaster PMID: 12881720
  4. LUSH, a soluble odorant-binding protein, undergoes a major conformational change, triggered by ligands. PMID: 14759510
  5. genetic interaction between lush and spontaneous activity in 11-cis vaccenyl acetate-sensitive neurons in the absence of pheromone PMID: 15664171
  6. Detection of odorants by olfactory neurons is results from direct activation of odorant receptors by odor molecules; study shows that detection of the 11-cis vaccenyl acetate (cVA), is instead mediated by pheromone-induced conformational shifts in LUSH. PMID: 18585358

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PBP/GOBP family
Tissue Specificity
Specifically expressed in chemosensory system in both males and females. Expressed in a subset of trichoid chemosensory sensilla located on the ventral-lateral surface of the third antennal segment. Secreted from non-neuronal support cells into the sensil
Database Links

KEGG: dme:Dmel_CG8807

STRING: 7227.FBpp0074737

UniGene: Dm.2522

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*