Home
Protein
Recombinant Proteins
Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

Recombinant Enterobacteria phage 933W Shiga-like toxin 2 subunit B (stxB2)

^{In Stock}

Code	CSB-YP357663ECC
Abbreviation	Recombinant Enterobacteria phage 933W stxB2 protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

stxB2

Uniprot No.

P09386

Research Area

Others

Alternative Names

stxB2; stx2B; L0104; Shiga-like toxin 2 subunit B; SLT-2 B subunit; SLT-2b; SLT-IIb; Verocytotoxin 2 subunit B; Verotoxin 2 subunit B

Species

Enterobacteria phage 933W (Bacteriophage 933W)

Source

Yeast

Expression Region

20-89aa

Target Protein Sequence

ADCAKGKIEFSKYNEDDTFTVKVDGKEYWTSRWNLQPLLQSAQLTGMTVTIKSSTCESGSGFAEVQFNND
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

9.8kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Discover the exceptional quality of Recombinant Enterobacteria phage 933W stxB2, designed to support your research in bacteriophage studies and beyond. This protein is the Shiga-like toxin 2 subunit B (SLT-2 B subunit; SLT-2b; SLT-IIb), sourced from the Enterobacteria phage 933W, and expressed in yeast. With an expression region encompassing 20-89aa, this recombinant protein represents the full length of the mature protein.

Equipped with an N-terminal 6xHis-tag, the Recombinant Enterobacteria phage 933W stxB2 facilitates easy detection and purification. Its purity exceeds 90% as determined by SDS-PAGE, and it is supplied as a lyophilized powder. Rely on this meticulously crafted protein to bolster your research pursuits.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

The B subunit is responsible for the binding of the holotoxin to specific receptors on the target cell surface, such as globotriaosylceramide (Gb3) in human intestinal microvilli.

Subcellular Location

Secreted.

Protein Families

StxB family

Database Links

KEGG: vg:1262010

Promotions