Name: Recombinant Enterobacteria phage MS2 Capsid protein
Brand: CUSABIO
SKU: CSB-EP365998ECZ

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

N/A

Uniprot No.

P03612

Research Area

Others

Alternative Names

Capsid protein; CP; Coat protein

Species

Escherichia phage MS2 (Bacteriophage MS2)

Source

E.coli

Expression Region

2-130aa

Target Protein Sequence

ASNFTQFVLVDNGGTGDVTVAPSNFANGVAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIKVEVPKVATQTVGGVELPVAAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

21.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer，50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Recombinant Escherichia phage MS2 Capsid protein is a high-quality product specifically designed for researchers studying bacteriophages and related fields. The Capsid protein (CP; Coat protein) originates from Escherichia phage MS2 and is expressed in E. coli, providing a full-length mature protein with an expression region covering 2-130aa.

Featuring both N-terminal 10xHis-tagged and C-terminal Myc-tagged constructs, this recombinant protein offers seamless detection and purification processes. With a purity of greater than 85% as determined by SDS-PAGE, the Escherichia phage MS2 Capsid protein is provided in the form of lyophilized powder, ensuring a dependable and effective product for your research needs.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Please can you provide sequence, pricing, availability and tag information for all available sizes of all available expression hosts?
I am most concerned about the tag information. I ask about the tagged forms available for this protein. I would prefer a protein fused to maltose binding protein or a GST tagged protein are better. Do you have any of these products available?

Very nice to receive your inquiry. Recombinant Enterobacteria phage MS2 Capsid protein
CSB-YP365998ECZ >> Yeast
CSB-EP365998ECZ >> E.coli
CSB-BP365998ECZ >> Baculovirus
CSB-MP365998ECZ >> Mammalian cell
You can view the full sequence and tag information on this page.
We can meet your demand to provide a protein fused to maltose binding protein or a GST tagged protein, pls remark this requirement when placing the order.
There isn't any extra charges, and the lead time won't be extended.

Target Background

Function

Capsid protein self-assembles to form an icosahedral capsid with a T=3 symmetry, about 26 nm in diameter, and consisting of 89 capsid proteins dimers (178 capsid proteins). Involved in viral genome encapsidation through the interaction between a capsid protein dimer and the multiple packaging signals present in the RNA genome. The capsid contains also 1 copy of the A2 maturation protein.; Acts as a translational repressor of viral replicase synthesis late in infection. This latter function is the result of capsid protein interaction with an RNA hairpin which contains the replicase ribosome-binding site.

Gene References into Functions

When the MS2 capsid assembles, the conformation of bound RNA and its interaction with the PRR1 coat-protein dimer are similar in both small RNA phages PRR1 and phage MS2. PMID: 23519411
A new concept in virus biology provides predictive information on structural constraints on coat protein and genome topography, revealing a previously unrecognized structural interdependence of the shapes and sizes of different viral components. PMID: 23403965
This study shows that translational repressor binding results in self-association of asymmetric (AB) dimers being inhibited, whilst association of AB with symmetric (CC) dimers is greatly enhanced. PMID: 20562027
MS2 coat protein binds several Escherichia coli mRNAs in vitro PMID: 11058143

Subcellular Location

Virion.

Protein Families

Levivirus capsid protein family

Database Links

KEGG: vg:1260899

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address