Recombinant Enterobacteria phage T4 Endolysin (E)

In Stock
Code CSB-EP360435EDZ
Abbreviation Recombinant Enterobacteria phage T4 Endolysin protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP360435EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) E.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP360435EDZ could indicate that this peptide derived from E.coli-expressed Enterobacteria phage T4 (Bacteriophage T4) E.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
E
Uniprot No.
Research Area
Microbiology
Alternative Names
E; Endolysin; EC 3.2.1.17; Lysis protein; Lysozyme; Muramidase
Species
Enterobacteria phage T4 (Bacteriophage T4)
Source
E.coli
Expression Region
1-164aa
Target Protein Sequence
MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
34.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Our Recombinant Enterobacteria phage T4 Endolysin is a high-quality protein designed to meet the demands of researchers in the field of microbiology. This full-length protein, with an expression region spanning 1-164aa, is sourced from the Enterobacteria phage T4, also known as Bacteriophage T4.

The protein is expressed in E. coli and features an N-terminal 6xHis-SUMO-tag for convenient detection and purification. With a purity greater than 90% as determined by SDS-PAGE, this Recombinant Enterobacteria phage T4 Endolysin is provided as a lyophilized powder, ensuring a reliable and efficient product for your research needs.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Endolysin with lysozyme activity that degrades host peptidoglycans and participates with the holin and spanin proteins in the sequential events which lead to the programmed host cell lysis releasing the mature viral particles. Once the holin has permeabilized the host cell membrane, the endolysin can reach the periplasm and break down the peptidoglycan layer.
Gene References into Functions
  1. Cryoelectron microscopy analysis of small heat shock protein 16.5 (Hsp16.5) complexes with T4 lysozyme reveals the structural basis of multimode binding PMID: 23277356
  2. Data indicate that the N-terminal fused T4 lysozyme (T4L) is sufficiently rigid relative to the beta(2) adrenergic receptor (beta(2)AR) to facilitate crystallogenesis. PMID: 23056231
Subcellular Location
Host cytoplasm.
Protein Families
Glycosyl hydrolase 24 family
Database Links

KEGG: vg:1258585

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*