Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Microbiology
Alternative Names
E; Endolysin; EC 3.2.1.17; Lysis protein; Lysozyme; Muramidase
Species
Enterobacteria phage T4 (Bacteriophage T4)
Expression Region
1-164aa
Target Protein Sequence
MNIFEMLRIDERLRLKIYKDTEGYYTIGIGHLLTKSPSLNAAKSELDKAIGRNCNGVITKDEAEKLFNQDVDAAVRGILRNAKLKPVYDSLDAVRRCALINMVFQMGETGVAGFTNSLRMLQQKRWDEAAVNLAKSIWYNQTPNRAKRVITTFRTGTWDAYKNL
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Our Recombinant Enterobacteria phage T4 Endolysin is a high-quality protein designed to meet the demands of researchers in the field of microbiology. This full-length protein, with an expression region spanning 1-164aa, is sourced from the Enterobacteria phage T4, also known as Bacteriophage T4.
The protein is expressed in E. coli and features an N-terminal 6xHis-SUMO-tag for convenient detection and purification. With a purity greater than 90% as determined by SDS-PAGE, this Recombinant Enterobacteria phage T4 Endolysin is provided as a lyophilized powder, ensuring a reliable and efficient product for your research needs.
