Recombinant Enterobacteria phage lambda Host-nuclease inhibitor protein gam (gam)

In Stock
Code CSB-EP356122ECW
Abbreviation Recombinant Escherichia phage lambda Host-nuclease inhibitor protein gam protein
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
gam
Uniprot No.
Research Area
Immunology
Alternative Names
gam; gamma; Host-nuclease inhibitor protein gam
Species
Escherichia phage lambda (Bacteriophage lambda)
Source
E.coli
Expression Region
1-138aa
Target Protein Sequence
MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The region for expressing recombinant Escherichia phage lambda gam contains amino acids 1-138. This gam protein is expected to have a theoretical molecular weight of 23.8 kDa. The gam protein was expressed in e.coli. The N-terminal 10xHis tag and C-terminal Myc tag was smoothly integrated into the coding gene of gam, which enables a simple process of detecting and purifying the gam recombinant protein in the following steps.

The Enterobacteria phage lambda host-nuclease inhibitor protein Gam is a crucial player in the life cycle of bacteriophage lambda. Gam functions as an inhibitor of the host's RecBCD exonuclease, preventing it from degrading the phage's linear DNA upon infection. By inhibiting RecBCD, Gam allows the phage to protect its DNA and facilitates its circularization and integration into the host genome during the lysogenic cycle. The interaction between Gam and RecBCD is specific and helps the phage establish a successful infection. Understanding the mechanisms of Gam and its interactions with the host's DNA repair machinery is essential for gaining insights into phage biology and developing strategies to control bacterial infections.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to host RecBCD nuclease and inhibits it thereby protecting the viral DNA against recBCD mediated degradation.
Database Links

KEGG: vg:2703509

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*