Recombinant Enterobacteria phage lambda Host-nuclease inhibitor protein gam(gam)

In Stock
Code CSB-EP356122ECW
Product Type Recombinant Protein
Size EP: USD912
Uniprot No. P03702
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia phage lambda (Bacteriophage lambda)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MDINTETEIKQKHSLTPFPVFLISPAFRGRYFHSYFRSSAMNAYYIQDRLEAQSWARHYQQLAREEKEAELADDMEKGLPQHLFESLCIDHLQRHGASKKSITRAFDDDVEFQERMAEHIRYMVETIAHHQVDIDSEV
Research Area Immunology
Source E.coli
Gene Names gam
Protein Names Recommended name: Host-nuclease inhibitor protein gam
Expression Region 1-138aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 23.8 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to host RecBCD nuclease and inhibits it thereby protecting the viral DNA against recBCD mediated degradation.
Database Links

KEGG: vg:2703509

Related Products

gam Antibodies

gam Antibodies for Escherichia phage lambda (Bacteriophage lambda)

gam Proteins

gam Proteins for Escherichia phage lambda (Bacteriophage lambda)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.