Recombinant Epstein-Barr virus Latent membrane protein 1(LMP1),partial

In Stock
Code CSB-YP318333EFE
Size US$1916Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP318333EFE could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.
  • Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP318333EFE could indicate that this peptide derived from Yeast-expressed Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4) LMP1.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

To produce recombinant EBV LMP1 protein, a well-established recombinant DNA technology is the key. A DNA template of LMP1 was constructed with N-terminal 6xHis tag using the technique. Once the template was made, the recombinant EBV LMP1 protein could be produced with it efficiently. CUSABIO has built a strict QC system to ensure quality. The expression region is 185-386aa of the EBV LMP1. The purity of this recombinant is 90% determined by SDS-PAGE. (And the activity has been tested.)

LMP1 (BNLF1) is a protein coding gene that encodes Latent membrane protein 1. According to some studies, LMP1 may have the following features.
The Epstein-Barr virus transforming protein LMP1 engages the signaling proteins of the tumor necrosis factor receptor family. Epstein-Barr virus nuclear antigen 2 can transduce the latent membrane protein LMP1. Clonality and tumorigenicity of human epithelial cells expressing the Epstein-Barr virus-encoded membrane protein LMP1. LMP1 is known to be an oncogene in rodent fibroblasts and induces B lymphocyte activation and cell adhesion molecules in the Epstein-Barr virus-negative Burkitt's lymphoma cell line Louckes. Differences between LMP1 transcript and protein detection in NPC and highlight the role of EBV miRNAs in regulating LMP1 downstream signaling to promote cancer development. The subsequent loss of LMP1 expression may affect sites of persistent latent infection.

Purity Greater than 90% as determined by SDS-PAGE.
Target Names LMP1
Uniprot No. P13198
Alternative Names LMP1; BNLF1; Latent membrane protein 1; LMP-1; Protein p63
Species Epstein-Barr virus (strain Raji) (HHV-4) (Human herpesvirus 4)
Source Yeast
Expression Region 185-386aa
Target Protein Sequence YYHGQRHSDEHHHDDSLPHPQQATDDSSNQSDSNSNEGRHLLLVSGAGDGPPLCSQNLGAPGGGPNNGPQDPDNTDDNGPQDPDNTDDNGPHDPLPQDPDNTDDNGPQDPDNTDDNGPHDPLPHNPSDSAGNDGGPPQLTEEVENKGGDQGPPLMTDGGGGHSHDSGHDGIDPHLPTLLLGTSGSGGDDDDPHGPVQLSYYD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 23.0 kDa
Protein Length Partial
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer Tris-based buffer,50% glycerol
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Earn $30 Amazon Card or 20μL/μg CUSABIO Trial Size Antibody. Details of rewards >>

Target Background

Function
(From Uniprot)
Acts as a CD40 functional homolog to prevent apoptosis of infected B-lymphocytes and drive their proliferation. Functions as a constitutively active tumor necrosis factor receptor that induces the activation of several signaling pathways, including those of the NF-kappa-B family. LMP1 signaling leads to up-regulation of antiapoptotic proteins and provide growth signals in latently infected cells. Interacts with host UBE2I and subsequently affects the sumoylation state of several cellular proteins. For example, induces the sumoylation of host IRF7 thereby limiting its transcriptional activity and modulating the activation of innate immune responses. Inhibits also host IFN-alpha-stimulated STAT2 nuclear translocation and interferon-stimulated response element transcriptional activity by interacting with and inhibiting host TYK2.
Subcellular Location Host cell membrane; Multi-pass membrane protein.
Protein Families Herpesviridae LMP-1 family

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2021 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1