Recombinant Epstein-Barr virus Viral interleukin-10 homolog (BCRF1)

In Stock
Code CSB-EP365869EFA
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
BCRF1
Uniprot No.
Research Area
Others
Alternative Names
BCRF1; Viral interleukin-10 homolog; vIL-10; 20 kDa protein; Protein BCRF1
Species
Epstein-Barr virus(strain B95-8)(HHV-4)(Human herpesvirus 4)
Source
E.coli
Expression Region
24-170aa
Target Protein Sequence
TDQCDNFPQMLRDLRDAFSRVKTFFQTKDEVDNLLLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENQDPEAKDHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQIKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTIKAR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
24.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Tris-based buffer,50% glycerol
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in masking infected cells for immune recognition by cytotoxic T-lymphocytes. Down-regulates the expression of the host TAP1 gene (transporter associated with antigen processing), thereby affecting the transport of peptides into the endoplasmic reticulum and subsequent peptide loading by MHC class I molecules. Inhibits IFN-gamma synthesis.
Gene References into Functions
  1. Our results demonstrate that late genes, BCRF1 and BPLF1, encoding immunomodulatory proteins are transcribed by a mechanism distinct from late genes encoding viral structural proteins PMID: 27855219
  2. This viral pre-initiation complex is composed of five different proteins in addition to Epstein-Barr virus BcRF1 and interacts with cellular RNA polymerase II PMID: 25165108
  3. Using EBV mutants deficient in BCRF1 and BNLF2a, findings show that both factors contribute to evading EBV-specific immune responses during the earliest phase of infection. PMID: 22615564
  4. The authors show here that BcRF1 forms a complex with the TATT motif and that this interaction is required for activation of late viral gene expression. Moreover, our results suggest that BcRF1 acts via interaction with other viral proteins. PMID: 22457524
  5. study indicates v-IL10 (BCRF1)is a conserved gene especially in its functional domains; pattern B95-8 is the commonest in Northern China; pattern SPM seems to be associated to EBV-positive nasopharyngeal and laryngopharyngeal epithelial cells PMID: 21328379

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-10 family
Database Links

KEGG: vg:3783689

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 322 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join Us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2023 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*