Recombinant Escherichia coli Glutaminase 1(glsA1)

Code CSB-EP302868ENV
Product Type Recombinant Protein
Size US$2466
Uniprot No. P77454
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MLDANKLQQAVDQAYTQFHSLNGGQNADYIPFLANVPGQLAAVAIVTCDGNVYSAGDSDYRFALESISKVCTLALALEDVGPQAVQDKIGADPTGLPFNSVIALELHGGKPLSPLVNAGAIATTSLINAENVEQRWQRILHIQQQLAGEQVALSDEVNQSEQTTNFHNRAIAWLLYSAGYLYCDAMEACDVYTRQCSTLLNTIELATLGATLAAGGVNPLTHKRVLQADNVPYILAEMMMEGLYGRSGDWAYRVGLPGKSGVGGGILAVVPGVMGIAAFSPPLDEDGNSVRGQKMVASVAKQLGYNVFKG
Research Area Others
Source E.coli
Gene Names glsA1
Protein Names Recommended name: Glutaminase 1 EC= 3.5.1.2
Expression Region 1-310aa
Tag Info N-terminal 6xHis-GST-tagged
Mol. Weight 62.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat

Related Products

glsA1 Antibodies

glsA1 Antibodies for Escherichia coli

glsA1 Proteins

glsA1 Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.