Recombinant Escherichia coli Agmatinase(speB)

In Stock
Code CSB-EP001447ENM
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. B7LFJ6
Lead Time 3-7 business days
Relevance Catalyzes the formation of putrescine from agmatine.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Agmatine ureohydrolase Short name:AUH
Species Escherichia coli (strain 55989 / EAEC)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSTLGHQYDNSLVSNAFGFLRLPMNFQPYDSDADWVITGVPFDMATSGRAGGRHGPAAIRQVSTNLAWEHNRFPWNFDMRERLNVVDCGDLVYAFGDAREMSEKLQAHAEKLLAAGKRMLSFGGDHFVTLPLLRAHAKHFGKMALVHFDAHTDTYANGCEFDHGTMFYTAPKEGLIDPNHSVQIGIRTEFDIDNGFTVLDACQVNDRSVDDVIAQVKQIVGDMPVYLTFDIDCLDPAFAPGTGTPVIGGLTSDRAIKLVRGLKDLNIVGMDVVEVAPAYDQSEITALAAATLALEMLYIQAAKKGE
Research Area Microbiology
Source E.coli
Gene Names speB
Expression Region 1-306aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 49.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes the formation of putrescine from agmatine.
Protein Families Arginase family, Agmatinase subfamily
Database Links

KEGG: eck:EC55989_3229

Related Products

speB Antibodies

speB Antibodies for Escherichia coli (strain 55989 / EAEC)

speB Proteins

speB Proteins for Escherichia coli (strain 55989 / EAEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.