Recombinant Escherichia coli Beta-lactamase CTX-M-1(bla)

In Stock
Code CSB-EP333368ENL
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P28585
Relevance Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333368ENL could indicate that this peptide derived from E.coli-expressed Escherichia coli bla.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333368ENL could indicate that this peptide derived from E.coli-expressed Escherichia coli bla.
Storage Buffer Tris-based buffer,50% glycerol
Alias Beta-lactamase MEN-1Cefotaximase 1
Species Escherichia coli
Purity Greater than 90% as determined by SDS-PAGE.
Sequence QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Research Area Others
Source E.coli
Gene Names bla
Protein Names Beta-lactamase MEN-1Cefotaximase 1
Expression Region 29-291aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 32.2 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Broad spectrum beta-lactamase which confers resistance to penicillins, as well as first, second and third-generation cephalosporins.
Protein Families Class-A beta-lactamase family
Database Links

KEGG: ag:CAA63262

Related Products

bla Antibodies

bla Antibodies for Escherichia coli

bla Proteins

bla Proteins for Escherichia coli

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.