Home
Protein
Recombinant Proteins
Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla)

Recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla)

^{In Stock}

Code	CSB-EP333368ENL
Abbreviation	Recombinant E.coli bla protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333368ENL could indicate that this peptide derived from E.coli-expressed Escherichia coli bla. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP333368ENL could indicate that this peptide derived from E.coli-expressed Escherichia coli bla.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

bla

Uniprot No.

P28585

Research Area

Others

Alternative Names

bla; men1Beta-lactamase CTX-M-1; EC 3.5.2.6; Beta-lactamase MEN-1; Cefotaximase 1

Species

Escherichia coli

Source

E.coli

Expression Region

29-291aa

Target Protein Sequence

QTADVQQKLAELERQSGGRLGVALINTADNSQILYRADERFAMCSTSKVMAVAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVDGTMSLAELSAAALQYSDNVAMNKLISHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDPRDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGSGDYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTNGL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

32.2 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Escherichia coli Beta-lactamase CTX-M-1 (bla) was produced as a fusion protein with N-terminal 6xHis tagged in E.coli. The encoding sequence contains 29-291aa of Escherichia coli bla protein. This full-length of mature bla protein reached up to 90% in purity, which is measured by SDS-PAGE. It migrated to a molecular mass band of 32 kDa on the gel. It was also validated by the LC-MS/MS analysis. In-stock bla proteins are offered now. This recombinant bla protein may find uses in the specific antibody synthesis or the studies of microbiology.

blaCTX-M-1 is the most frequently detected extended-spectrum β-lactamases (ESBL)-encoding gene. Its encoding protein is a broad spectrum beta-lactamase that confers resistance to penicillins, as well as first, second, and third-generation cephalosporins.