Recombinant Escherichia coli Carbon storage regulator(csrA)

In Stock
Code CSB-EP543019ENTe1
Product Type Recombinant Protein
Size US$464
Uniprot No. B1XCM4
Lead Time 3-7 business days
Relevance Affects glycogen biosynthesis, gluconeogenesis, cell size and surface properties. Regulates glycogen synthesis under both aerobic and anaerobic conditions. Seems to accelerate the degradation of glg gene transcripts, potentially through selective RNA binding. Acts to inhibit interaction between the LetD protein and the A subunit of DNA gyrase. Also required for motility and flagellum biosynthesis through the post-transcriptional activation of flhDC expression. This involves binding to and stabilization of the flhDC message by CsrA.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12 / DH10B)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY
Research Area Others
Source E.coli
Gene Names csrA
Expression Region 1-61aa
Tag Info Tag-Free
Mol. Weight 6.9 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s).
Subcellular Location Cytoplasm
Protein Families CsrA/RsmA family
Database Links

KEGG: ecd:ECDH10B_2864

Related Products

csrA Antibodies

csrA Antibodies for Escherichia coli

csrA Proteins

csrA Proteins for Escherichia coli (strain K12 / DH10B)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.