Recombinant Escherichia coli Translational regulator CsrA (csrA)

In Stock
Code CSB-EP543019ENTe1
Abbreviation Recombinant E.coli csrA protein
MSDS
Size US$554
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
csrA
Uniprot No.
Research Area
Others
Alternative Names
csrA; ECDH10B_2864; Translational regulator CsrA; Carbon storage regulator
Species
Escherichia coli (strain K12 / DH10B)
Source
E.coli
Expression Region
1-61aa
Target Protein Sequence
MLILTRRVGETLMIGDEVTVTVLGVKGNQVRIGVNAPKEVSVHREEIYQRIQAEKSQQSSY
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
6.9 kDa
Protein Length
Full Length
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The recombinant E.coli csrA protein is encoded by the gene of csrA (1-61aa). The gene of csrA was cloned in a system (E.coli) that supported the expression of csrA and translation of messenger RNA. Modification of csrA by recombinant DNA technology could lead to the expression of the target protein. The purity is 85% determined by SDS-PAGE.

CsrA is a protein coding gene that encodes Translational regulator CsrA. According to some research, CsrA may have the following features.
Global regulation of small RNA binding protein CsrA and non-coding RNA molecule CsrB. Post-transcriptional global regulation of CsrA in bacteria. Under the influence of Escherichia coli global regulator CsrA, the formation and spread of biofilms. The RNA molecule CsrB binds to the global regulatory protein CsrA and antagonizes its activity in E. coli. CsrA regulates the translation of the carbon starvation gene cstA in E. coli by blocking ribosome access to cstA transcripts. The regulatory loops of E. coli CsrA/CsrB and BarA/UvrY systems. Identification and molecular characteristics of the polymorphic gene csrA in Escherichia coli, which affects glycogen biosynthesis, glucose production, cell size and surface characteristics.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
A key translational regulator that binds mRNA to regulate translation initiation and/or mRNA stability. Mediates global changes in gene expression, shifting from rapid growth to stress survival by linking envelope stress, the stringent response and the catabolite repression systems. Usually binds in the 5'-UTR; binding at or near the Shine-Dalgarno sequence prevents ribosome-binding, repressing translation, binding elsewhere in the 5'-UTR can activate translation and/or stabilize the mRNA. Its function is antagonized by small RNA(s).
Subcellular Location
Cytoplasm.
Protein Families
CsrA/RsmA family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*