Home
Protein
Recombinant Proteins
Recombinant Escherichia coli F41 fimbrial protein (FimF41a)

Recombinant Escherichia coli F41 fimbrial protein (FimF41a)

^{In Stock}

Code	CSB-EP320917ENL
Abbreviation	Recombinant E.coli FimF41a protein
MSDS	MSDS Datasheet
Size	$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

FimF41a

Uniprot No.

P11900

Research Area

Microbiology

Alternative Names

Adhesin F41

Species

Escherichia coli

Source

E.coli

Expression Region

23-277aa

Target Protein Sequence

ADWTEGQPGDIIIGGEITSPSVKWLWKTGEGLSSFSNTTNEIVKRKLNISVPTDELFLAAKMSDGIKGVFVGNTLIPKIEMASYDGSVITPSFTSNTAMDIAVKVKNSGDNTELGTLSVPLSFGAAVATIFDGDTTDSAVAHIIGGSAGTVFEGLVNPGRFTDQNIAYKWNGLSKAEMAGYVEKLMPGQSASTSYSGFHNWDDLSHSNYTSANKASYLSYGSGVSAGSTLVMNLNKDVAGRLEWVAPVTITVIYS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.4 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Upon evaluation of different signal peptides for the secretory production of recombinant bovine pancreatic ribonuclease A in Gram-negative bacterial systems [1], found that FimF41a, along with other signal peptides such as Phage shock protein E (pspE), pectate lyase B (PelB), and Lipopolysaccharide export system protein lptA, were identified as the best signal peptides for expressing RNase A protein in E. coli [1]. This suggests that FimF41a may play a crucial role in the secretory pathway and could be involved in the translocation of proteins across the bacterial membrane.

References:
[1] A. Forouharmehr, M. Nassiri, S. Ghovvati, & A. Javadmanesh, "Evaluation of different signal peptides for secretory production of recombinant bovine pancreatic ribonuclease a in gram negative bacterial system: an in silico study", Current Proteomics, vol. 15, no. 1, 2018. https://doi.org/10.2174/1570164614666170725144424

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Fimbriae (also called pili), polar filaments radiating from the surface of the bacterium to a length of 0.5-1.5 micrometers and numbering 100-300 per cell, enable bacteria to colonize the epithelium of specific host organs.

Subcellular Location

Fimbrium.

Protein Families

Fimbrial K88 protein family

Promotions