Recombinant Escherichia coli Inositol-1-monophosphatase (suhB)

Code CSB-RP085444Ba
MSDS
Size US$388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
suhB
Uniprot No.
Research Area
Others
Alternative Names
suhB; ssyA; b2533; JW2517; Inositol-1-monophosphatase; I-1-Pase; IMPase; Inositol-1-phosphatase; EC 3.1.3.25
Species
Escherichia coli (strain K12)
Source
E.coli
Expression Region
1-267aa
Target Protein Sequence
MHPMLNIAVRAARKAGNLIAKNYETPDAVEASQKGSNDFVTNVDKAAEAVIIDTIRKSYPQHTIITEESGELEGTDQDVQWVIDPLDGTTNFIKRLPHFAVSIAVRIKGRTEVAVVYDPMRNELFTATRGQGAQLNGYRLRGSTARDLDGTILATGFPFKAKQYATTYINIVGKLFNECADFRRTGSAALDLAYVAAGRVDGFFEIGLRPWDFAAGELLVREAGGIVSDFTGGHNYMLTGNIVAGNPRVVKAMLANMRDELSDALKR
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
56.2kDa
Protein Length
Full Length
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Part of the processive rRNA transcription and antitermination complex (rrnTAC). The complex forms an RNA-chaperone ring around the RNA exit tunnel of RNA polymerase (RNAP). It supports rapid transcription and antitermination of rRNA operons, cotranscriptional rRNA folding, and annealing of distal rRNA regions to allow correct ribosome biogenesis. This subunit may play a central role in organizing the structure. Involved in 30S ribosomal subunit biogenesis; thought to be required for loop formation between NusB/NusE (rpsJ, ribosomal protein S10) bound to boxA upstream of the rRNA operons and the elongating RNAP complex. This would promote correct co-transcriptional folding of rRNA. Plays a role in transcription antitermination in a plasmid context in vivo. Required for rrn transcription antitermination; required for integration of NusB/NusE into the antitermination complex. The Nus factor complex (NusA, NusB, NusE (rpsJ), NusG and SuhB) represses expression of suhB and possibly other genes via boxA; the Nus complex prevents or promotes Rho-mediated transcription termination depending on gene context. Involved in post-transcriptional control of gene expression (Probable). Enzymatic activity is not required for complementation of the cold-sensitive phenotype of the dnaB121 mutation (Probable).; Has D,L-inositol-1-monophosphatase and beta-glycerophosphatase activity, has less to no activity against a number of other substrates. 2.5-fold more active on 1D-inositol-1-monophosphate than L-inositol-1-monophosphate (1D-myo-inositol 3-phosphate). Specific activity increases significantly upon heating. Only beta-glycerophosphate and adenosine 2'-monophosphate are alternative substrates.; Required for growth at low temperatures. Identified as a suppressor (ssyA3) of a temperature-sensitive, protein export missense mutation of secY (secY24), allows growth at 42 but not 30 degrees Celsius. Identified as a suppressor (suhB2) of an rpoH missense mutation (rpoH15), allowing growth at 37 and 40 but not 25, 30 or 34 degrees Celsius, increases expression of RpoH. Identified as a suppressor of a dnaB helicase missense mutation (dnaB121), restores growth at 42 but not 30 degrees Celsius. In both suhB2 and ssyA3 there is an insertion in the 5' region of the gene which prevents SuhB protein expression. Missense mutant suhB10 is suppressed by mutations in RNase III (rnc), showing genetic interaction between them. Deletion of suhB is suppressed by mutations in RNase III, by a mutation in nusA or deletion of nusB, indicating that in the absence of SuhB the Nus complex inhibits growth.
Gene References into Functions
  1. The authors demonstrate that the main function of this SuhB-containing complex is not to prevent premature transcription termination within the rRNA operon, as had been long claimed, but to enable rRNA maturation and a functional ribosome fully competent for translation. PMID: 26980831
Subcellular Location
Cytoplasm.
Protein Families
Inositol monophosphatase superfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*