Recombinant Escherichia coli O6:H1 Lipopolysaccharide export system protein LptC(lptC)

Code CSB-EP360015EGXa2
Product Type Recombinant Protein
Size US$2466
Uniprot No. P0ADW0
Relevance Involved in the assbly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner mbrane to the outer mbrane. Facilitates the transfer of LPS from the inner mbrane to the periplasmic protein LptA. Could be a docking site for LptA.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MSKARRWVIIVLSLAVLVMIGINMAEKDDTAQVVVNNNDPTYKSEHTDTLVYNPEGALSYRLIAQHVEYYSDQAVSWFTQPVLTTFDKDKIPTWSVKADKAKLTNDRMLYLYGHVEVNALVPDSQLRRITTDNAQINLVTQDVTSEDLVTLYGTTFNSSGLKMRGNLRSKNAELIEKVRTSYEIQNKQTQP
Research Area Others
Source E.coli
Gene Names lptC
Expression Region 1-191aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 37.7 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the assembly of lipopolysaccharide (LPS). Required for the translocation of LPS from the inner membrane to the outer membrane. Facilitates the transfer of LPS from the inner membrane to the periplasmic protein LptA. Could be a docking site for LptA.
Subcellular Location Cell inner membrane, Single-pass membrane protein
Protein Families LptC family
Database Links

KEGG: ecc:c3959

STRING: 199310.c3959

Related Products

lptC Antibodies

lptC Antibodies for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

lptC Proteins

lptC Proteins for Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.