| Code | CSB-EP419575EJF |
| Abbreviation | Recombinant E.coli O9:H4 lolA protein |
| MSDS | |
| Size | US$388 |
| Order now | |
| Image | |
| Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
I have some questions about CSB-EP419575EJF Recombinant Escherichia coli O9:H4 (strain HS) Outer-membrane lipoprotein carrier protein.
1.How long does it take to deliver 1mg of protein?
2.What is the concentration of the protein?
3.Do you do any activity check?
4.Could you please provide me with the full sequence including his-tag and potential cleavage sites.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
KEGG: ecx:EcHS_A0996