Name: Recombinant Escherichia coli O9:H4 Outer-membrane lipoprotein carrier protein (lolA)
Brand: CUSABIO
SKU: CSB-EP419575EJF

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

lolA

Uniprot No.

A7ZYJ5

Research Area

Others

Alternative Names

lolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein

Species

Escherichia coli O9:H4 (strain HS)

Source

E.coli

Expression Region

22-203aa

Target Protein Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

24.3kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I have some questions about CSB-EP419575EJF Recombinant Escherichia coli O9:H4 (strain HS) Outer-membrane lipoprotein carrier protein.
1.How long does it take to deliver 1mg of protein?
2.What is the concentration of the protein?
3.Do you do any activity check?
4.Could you please provide me with the full sequence including his-tag and potential cleavage sites.

Very nice to receive your inquiry.
1. The lead time for 1mg is 10-15 working days
2. The specific concentration will be determined after production and shown in COA. If customer has special requirement for concentration, please kindly confirm with us in pre-sales and remark in PO.
3. We haven't validated the activity of this protein. This protein is derived from Escherichia coli, which is full length of mature protein expressed in prokaryotic expression system.
Its expression form is supernatant and can maintain its activity in theory, but we haven't performed validation yet.
4. The following is the complete sequence including tag sequence and target protein sequence.

MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEFRT+DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK

The sequence in front of "+" is the tag sequence, and the sequence behind of "+" is the target protein sequence.

Target Background

Function

Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane).

Subcellular Location

Periplasm.

Protein Families

LolA family

Database Links

KEGG: ecx:EcHS_A0996

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address