Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

lolA

Uniprot No.

A7ZYJ5

Research Area

Others

Alternative Names

lolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein

Species

Escherichia coli O9:H4 (strain HS)

Source

Yeast

Expression Region

22-203aa

Target Protein Sequence

DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

22.3 kDa

Protein Length

Full Length of Mature Protein

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Escherichia coli O9:H4 (strain HS) lolA covers amino acids 22-203. This lolA protein is theoretically predicted to have a molecular weight of 22.3 kDa. This lolA protein is produced using yeast expression system. The lolA gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant lolA protein during the following stages.

The Escherichia coli outer-membrane lipoprotein carrier protein LolA, plays a crucial role in the transport of lipoproteins from the inner membrane to the outer membrane through the Sec-dependent pathway. LolA cooperates with another protein, LolB, to facilitate the insertion of lipoproteins into the outer membrane. LolA acts as a periplasmic chaperone, preventing premature interactions between lipoproteins and the outer membrane before their proper insertion. Understanding the function of LolA is essential for unraveling the complex processes involved in the biogenesis of the outer membrane in Escherichia coli.

Target Background

Function

Participates in the translocation of lipoproteins from the inner membrane to the outer membrane. Only forms a complex with a lipoprotein if the residue after the N-terminal Cys is not an aspartate (The Asp acts as a targeting signal to indicate that the lipoprotein should stay in the inner membrane).

Subcellular Location

Periplasm.

Protein Families

LolA family

Database Links

KEGG: ecx:EcHS_A0996

Code	CSB-YP419575EJF
Abbreviation	Recombinant E.coli O9:H4 lolA protein
MSDS	MSDS Datasheet
Size	$436
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP419575EJF could indicate that this peptide derived from Yeast-expressed Escherichia coli O9:H4 (strain HS) lolA. Based on the SEQUEST from database of Yeast host and target protein, the LC-MS/MS Analysis result of CSB-YP419575EJF could indicate that this peptide derived from Yeast-expressed Escherichia coli O9:H4 (strain HS) lolA.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Escherichia coli Outer-membrane lipoprotein carrier protein (lolA)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage