Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
lolA; EcHS_A0996; Outer-membrane lipoprotein carrier protein
Species
Escherichia coli O9:H4 (strain HS)
Expression Region
22-203aa
Target Protein Sequence
DAASDLKSRLDKVSSFHASFTQKVTDGSGAAVQEGQGDLWVKRPNLFNWHMTQPDESILVSDGKTLWFYNPFVEQATATWLKDATGNTPFMLIARNQSSDWQQYNIKQNGDDFVLTPKASNGNLKQFTINVGRDGTIHQFSAVEQDDQRSSYQLKSQQNGAVDAAKFTFTPPQGVTVDDQRK
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The expression region of this recombinant Escherichia coli O9:H4 (strain HS) lolA covers amino acids 22-203. This lolA protein is theoretically predicted to have a molecular weight of 22.3 kDa. This lolA protein is produced using yeast expression system. The lolA gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant lolA protein during the following stages.
The Escherichia coli outer-membrane lipoprotein carrier protein LolA, plays a crucial role in the transport of lipoproteins from the inner membrane to the outer membrane through the Sec-dependent pathway. LolA cooperates with another protein, LolB, to facilitate the insertion of lipoproteins into the outer membrane. LolA acts as a periplasmic chaperone, preventing premature interactions between lipoproteins and the outer membrane before their proper insertion. Understanding the function of LolA is essential for unraveling the complex processes involved in the biogenesis of the outer membrane in Escherichia coli.
