Recombinant Escherichia coli Transposase insE for insertion sequence IS3A(insE1)

Code CSB-MP317177ENV
Product Type Recombinant Protein
Size US$1400
Uniprot No. P0CF66
Relevance Involved in the transposition of the insertion sequence IS3.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MTKTVSTSKKPRKQHSPEFRSEALKLAERIGVTAAARELSLYESQLYNWRSKQQNQQTSSERELEMSTEIARLKRQLAERDEELAILQKAATYFAKRLK
Research Area Microbiology
Source Mammalian cell
Gene Names insE1
Protein Names Recommended name: Transposase insE for insertion sequence IS3A
Expression Region 1-99aa
Tag Info C-terminal Flag-tagged
Mol. Weight 22.1kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Involved in the transposition of the insertion sequence IS3.
Protein Families Transposase 8 family
Database Links

KEGG: ecj:JW5036

STRING: 316385.ECDH10B_2242

Related Products

insE1 Antibodies

insE1 Antibodies for Escherichia coli (strain K12)

insE1 Proteins

insE1 Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.