Code | CSB-EP356994ENV |
Abbreviation | Recombinant E.coli ompC protein |
MSDS | |
Size | $388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
There are currently no reviews for this product.
Because this protein is a several-times transmembrane protein, is there any particular reason why it isn't being expressed by the cell-free system? I was wondering if the protein should be provided in non-ionic detergent such as 0.03% n-OPE. What are your thoughts?
AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Could you please let me know the exact composition of the Tris-based buffer for this product? Thanks for your help.
KEGG: ecj:JW2203
STRING: 316385.ECDH10B_2372