Recombinant Escherichia coli Outer membrane protein C(ompC)


In Stock
Code CSB-EP356994ENVe1
Product Type Recombinant Protein
Size US$2632
Uniprot No. P06996
Relevance Forms pores that allow passive diffusion of small molecules across the outer mbrane.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356994ENVe1 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP356994ENVe1 could indicate that this peptide derived from E.coli-expressed Escherichia coli (strain K12) ompC.
Storage Buffer Tris-based buffer,50% glycerol
Species Escherichia coli (strain K12)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence AEVYNKDGNKLDLYGKVDGLHYFSDNKDVDGDQTYMRLGFKGETQVTDQLTGYGQWEYQIQGNSAENENNSWTRVAFAGLKFQDVGSFDYGRNYGVVYDVTSWTDVLPEFGGDTYGSDNFMQQRGNGFATYRNTDFFGLVDGLNFAVQYQGKNGNPSGEGFTSGVTNNGRDALRQNGDGVGGSITYDYEGFGIGGAISSSKRTDAQNTAAYIGNGDRAETYTGGLKYDANNIYLAAQYTQTYNATRVGSLGWANKAQNFEAVAQYQFDFGLRPSLAYLQSKGKNLGRGYDDEDILKYVDVGATYYFNKNMSTYVDYKINLLDDNQFTRDAGINTDNIVALGLVYQF
Research Area Others
Source E.coli
Gene Names ompC
Protein Names Outer membrane protein 1BPorin OmpC
Expression Region 22-367aa
Tag Info Tag-Free
Mol. Weight 38.3 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Forms pores that allow passive diffusion of small molecules across the outer membrane.
Subcellular Location Cell outer membrane, Multi-pass membrane protein
Protein Families Gram-negative porin family
Database Links

KEGG: ecj:JW2203

STRING: 316385.ECDH10B_2372

Related Products

ompC Antibodies

ompC Antibodies for Escherichia coli (strain K12)

ompC Proteins

ompC Proteins for Escherichia coli (strain K12)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.