Recombinant Geobacillus stearothermophilus Gellan lyase,partial

In Stock
Code CSB-EP308328GFM
Product Type Recombinant Protein
Size US$2466
Uniprot No. P85513
Lead Time 3-7 business days
Relevance Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Geobacillus stearothermophilus (Bacillus stearothermophilus)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR
Research Area Others
Source E.coli
Expression Region 1-204aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.5kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.
Subcellular Location Secreted

Related Products

Antibodies

Antibodies for Geobacillus stearothermophilus (Bacillus stearothermophilus)

Proteins

Proteins for Geobacillus stearothermophilus (Bacillus stearothermophilus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.