Recombinant Glycine max 2S seed storage albumin protein

In Stock
Code CSB-YP324829GGV
Abbreviation Recombinant Glycine max 2S seed storage albumin protein
MSDS
Size $436
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Alternative Names
2S albumin; GM2S-1; Napin-type 2S albumin 3) [Cleaved into: 2S albumin small chain; Aspartic acid-rich peptide; Lunasin); 2S albumin large chain; 8 kDa methionine-rich protein; 8 kDa MRP)]
Species
Glycine max (Soybean) (Glycine hispida)
Source
Yeast
Expression Region
22-158aa
Target Protein Sequence
SKWQHQQDSCRKQLQGVNLTPCEKHIMEKIQGRGDDDDDDDDDNHILRTMRGRINYIRRNEGKDEDEEEEGHMQKCCTEMSELRSPKCQCKALQKIMENQSEELEEKQKKKMEKELINLATMCRFGPMIQCDLSSDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
18.2kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The production of this Recombinant Glycine max Musk protein began at the genetic level, where the coding sequence for the Musk protein was first isolated and cloned into an expression plasmid vector. Recombinant DNA technology was used in the process. Next step was cloning. The expression vector must be introduced into the host cell (Yeast) so that the cells could be cultured and expressed the desired 2S albumin protein. And we finally got the recombinant 2S albumin protein with the purity of 90%+ determined by SDS-PAGE.

2S albumins, defined on the basis of their sedimentation coefficient, are a major group of seed storage proteins widely distributed in both mono- and di-cotyledonous plants. As storage proteins, they are deposited in protein bodies of developing seeds and are utilized by the plant as a source of nutrients (amino acids and carbon skeletons) during subsequent germination and seedling growth. Recent findings have demonstrated that 2S albumins can also play a protective role in plants as defensive weapons against fungal attack. In addition to their physiological role in plants, these small globular proteins are becoming of increasing interest in nutritional and clinical studies. The amino acid composition of 2S albumin proteins from many plant species has revealed their high content of sulphur-containing amino acids.

 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
This is a 2S seed storage protein.; binds to mammalian chromatin, preventing the normal formation of the kinetochore complex in the centromere and leading to the disruption of mitosis.
Gene References into Functions
  1. A potential strategy for recombinant production of bioactive lunasin in industry: production of anti-inflammatory agent by cloning a tandem repeat of Lunasin in Pichia pastoris. PMID: 29506820
  2. lunasin treatment could reverse the effects of ox-LDL on the expression of eNOS and PAI-1, the direct target genes of KLF2. Mechanistically, it was proven that the MEK5/ERK5 pathway mediates the effects of lunasin on KLF2 expression. PMID: 29096169
  3. lunasin will have promising potential as a novel nutritional supplement or drug candidate for RA due to its potency of suppressing synovial cell proliferation PMID: 25692134
Protein Families
2S seed storage albumins family
Tissue Specificity
Expressed in cotyledons (Ref.2). Maximal expression in parenchyma cells undergoing DNA endoreduplication and cell expansion but not in actively dividing cells of the cotyledon.
Database Links

KEGG: gmx:548076

STRING: 3847.GLYMA13G36400.1

UniGene: Gma.32309

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*