Recombinant Glycine max Leghemoglobin C2

In Stock
Code CSB-EP365720GGV
Abbreviation Recombinant Glycine max Leghemoglobin C2 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
N/A
Uniprot No.
Research Area
Others
Species
Glycine max (Soybean) (Glycine hispida)
Source
E.coli
Expression Region
2-145aa
Target Protein Sequence
GAFTEKQEALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLSNGVDPSNPKLTGHAEKLFGLVRDSAGQLKANGTVVADAALGSIHAQKAITDPQFVVVKEALLKTIKEAVGDKWSDELSSAWEVAYDELAAAIKKAF
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
21.4 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Leghemoglobin C2 is a protein found in soybean nodules, and it is one of the three major forms of leghemoglobin present in these nodules, alongside leghemoglobin a and cl [1]. The amino acid differences between leghemoglobin a and leghemoglobin c2 of soybean indicate that they are likely encoded by independent genes, but they possess highly similar tertiary structures [2]. This suggests that despite being encoded by different genes, these proteins share structural similarities.

The safety of using recombinant soy leghemoglobin in food has been investigated, and it has been reported that there are no potential allergenicity and toxigenicity associated with its use [3]. This conclusion was drawn from a literature search, bioinformatics analyses on the amino acid sequence of leghemoglobin and 17 Pichia host proteins, as well as in vitro pepsin digestibility of leghemoglobin. This indicates that leghemoglobin C2, as a form of soy leghemoglobin, is considered safe for consumption.

Furthermore, leghemoglobin uses an iron cofactor, and it has been speculated that a decrease in nodule GmSACPD-C iron binding may lead to an increase in leghemoglobin iron binding and expression [4]. This suggests that the regulation of iron binding may impact the expression and function of leghemoglobin C2 in soybean nodules.

References:
[1] E. Truelsen, K. Gausing, B. Jochimsen, P. Jørgensen, & K. Marcker, "Cloning of soybean leghemoglobin structural gene sequences synthesized in vitro", Nucleic Acids Research, vol. 6, no. 9, p. 3061-3072, 1979. https://doi.org/10.1093/nar/6.9.3061
[2] W. Brill, "Biochemical genetics of nitrogen fixation.", Microbiological Reviews, vol. 44, no. 3, p. 449-467, 1980. https://doi.org/10.1128/mmbr.44.3.449-467.1980
[3] J. Hadi and G. Brightwell, "Safety of alternative proteins: technological, environmental and regulatory aspects of cultured meat, plant-based meat, insect protein and single-cell protein", Foods, vol. 10, no. 6, p. 1226, 2021. https://doi.org/10.3390/foods10061226
[4] N. Lakhssassi, V. Colantonio, N. Flowers, Z. Zhou, J. Henry, S. Liuet al., "Stearoyl-acyl carrier protein desaturase mutations uncover an impact of stearic acid in leaf and nodule structure", Plant Physiology, vol. 174, no. 3, p. 1531-1543, 2017. https://doi.org/10.1104/pp.16.01929

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Provides oxygen to the bacteroids. This role is essential for symbiotic nitrogen fixation.
Protein Families
Plant globin family
Tissue Specificity
Root nodules.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*