Recombinant Halobacterium salinarum Cobalamin import ATP-binding protein BtuD(btuD)

In Stock
Code CSB-EP538512HTL
Product Type Recombinant Protein
Size US$2632
Uniprot No. B0R5G4
Lead Time 3-7 business days
Storage Buffer Tris-based buffer,50% glycerol
Species Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence MTLDVTGLDVELAGTRILDDVHASIRDGHLVGVVGPNGAGKSTLLRAMNGLITPTAGTVLVAGDDVHALSSAAASRRIATVPQDASVSFEFTVRQVVEMGRHPHTTRFGTDTDTAVVDRAMARTGVAQFAARDVTSLSGGERQRVLLARALAQAAPVLLLDEPTASLDVNHQIRTLEVVRDLADSEDRAVVAAIHDLDLAARYCDELVVVADGRVHDAGAPRSVLTPDTIRAAFDARVAVGTDPATGAVTVTPLPDRTSAAADTSVHVVGGGDSATPVVRRLVSAGASVSVGPVVEGDTDHETARRVGCPCTSVAPFTRLEDTTAASATRADIAAADVIAVPVAAAARPGVRGLLTGAVPTLAVGDAAGAPEWADRLVACDAVVSAVGALADTPSDGV
Research Area Others
Source E.coli
Gene Names btuD
Protein Names Recommended name: Cobalamin import ATP-binding protein BtuD EC= 3.6.3.33 Alternative name(s): Vitamin B12-transporting ATPase
Expression Region 1-398aa
Tag Info Tag-Free
Mol. Weight 40.5 kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Required for corrinoid utilization. Probably part of the ABC transporter complex BtuCDF involved in cobalamin (vitamin B12) import. Probably responsible for energy coupling to the transport system (By similarity).
Subcellular Location Cell membrane, Peripheral membrane protein
Protein Families ABC transporter superfamily
Database Links

KEGG: hsl:OE_2955F

Q&A and Customer Reviews

Q&A
Q:

I had a couple of questions regarding your protein CSB-EP538512HTL:
1.I plan to use this protein in AFM imaging experiments. Do you think aseptic processing and/or endotoxin removal are necessary for these experiments?
2.Can you advise whether or not this protein is suitable for lyophilization?

A:
Very nice to receive your inquiry.
1.We think aseptic processing or endotoxin removal are not necessary for these experiments.
2.Glycerol will be added into the buffer for liquid protein. If the glycerol will affect your experiments, lyophilized protein is suitable.
Customer Reviews

Related Products

btuD Antibodies

btuD Antibodies for Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

btuD Proteins

btuD Proteins for Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.