Home
Protein
Recombinant Proteins
Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)

Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)

^{In Stock}

Code	CSB-EP527126HVZ
Abbreviation	Recombinant Hepatitis E virus genotype 1 ORF3 protein
MSDS	MSDS Datasheet
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ORF3

Uniprot No.

O90299

Research Area

Others

Alternative Names

ORF3; Protein ORF3; pORF3

Species

Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)

Source

E.coli

Expression Region

1-114aa

Target Protein Sequence

MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

27.8kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant Hepatitis E virus genotype 1 ORF3 was expressed with the amino acid range of 1-114. The calculated molecular weight for this ORF3 protein is 27.8 kDa. This ORF3 protein is produced using e.coli expression system. Fusion of the N-terminal 6xHis-SUMO tag into the ORF3 encoding gene fragment was conducted, allowing for easier detection and purification of the ORF3 protein in subsequent stages.

The Hepatitis E virus genotype 1 (HEV-1) protein ORF3 is a viral protein encoded by the open reading frame 3 of the HEV genotype 1. HEV-1 ORF3 protein is involved in various aspects of the viral life cycle such as viral replication, assembly, and release. Additionally, HEV-1 ORF3 protein has been implicated in modulating host cell signaling and immune responses. Understanding the functions of HEV-1 ORF3 protein is crucial for unraveling the molecular mechanisms of HEV infection, and it may offer insights into potential targets for antiviral interventions.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function

Plays critical roles in the final steps of viral release by interacting with host TSG101, a member of the vacuolar protein-sorting pathway and using other cellular host proteins involved in vesicle formation pathway. Acts also as a viroporin and forms ion conductive pores allowing viral particle release. Impairs the generation of type I interferon by downregulating host TLR3 and TLR7 as well as their downstream signaling pathways.

Subcellular Location

Host endoplasmic reticulum membrane. Host cytoplasm.

Protein Families

Hepevirus ORF3 protein family

Promotions