Recombinant Hepatitis E virus genotype 1 Protein ORF3 (ORF3)


In Stock
Code CSB-EP527126HVZ
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. O90299
Lead Time 3-7 business days
Relevance May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR
Research Area Others
Source E.coli
Gene Names ORF3
Expression Region 1-114aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 27.8kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function May act as a viral regulatory protein involved in the modulation of mitogenic signaling pathways. May be involved in virion morphogenesis and viral pathogenesis. Expedites the processing and secretion of AMBP from the hepatocyte.
Subcellular Location Host cytoplasm, host cytoskeleton
Protein Families Hepevirus ORF3 protein family

Related Products

ORF3 Antibodies

ORF3 Antibodies for Hepatitis E virus genotype 1

ORF3 Proteins

ORF3 Proteins for Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.