Purity
Greater than 90% as determined by SDS-PAGE.
Alternative Names
ORF3; Protein ORF3; pORF3
Species
Hepatitis E virus genotype 1 (isolate Human/India/Hyderabad) (HEV-1)
Expression Region
1-114aa
Target Protein Sequence
MGSRPWALGLFCCCSSCFCLCCSRHRPVSRLAAVVGGAAAVPAVVSGVTGLILSPSQSPIFIQPTPSPRMSPLRPGLDLVFANPSDHSAPLGATRPSAPPLPHVVDLPQLGPRR
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The recombinant Hepatitis E virus genotype 1 ORF3 was expressed with the amino acid range of 1-114. The calculated molecular weight for this ORF3 protein is 27.8 kDa. This ORF3 protein is produced using e.coli expression system. Fusion of the N-terminal 6xHis-SUMO tag into the ORF3 encoding gene fragment was conducted, allowing for easier detection and purification of the ORF3 protein in subsequent stages.
The Hepatitis E virus genotype 1 (HEV-1) protein ORF3 is a viral protein encoded by the open reading frame 3 of the HEV genotype 1. HEV-1 ORF3 protein is involved in various aspects of the viral life cycle such as viral replication, assembly, and release. Additionally, HEV-1 ORF3 protein has been implicated in modulating host cell signaling and immune responses. Understanding the functions of HEV-1 ORF3 protein is crucial for unraveling the molecular mechanisms of HEV infection, and it may offer insights into potential targets for antiviral interventions.