Recombinant Hevea brasiliensis Pro-hevein(HEV1)

In Stock
Code CSB-EP365797HWI
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P02877
Lead Time 3-7 business days
Relevance N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence EQCGRQAGGKLCPNNLCCSQWGWCGSTDEYCSPDHNCQSNCKDSGEGVGGGSASNVLATYHLYNSQDHGWDLNAASAYCSTWDANKPYSWRSKYGWTAFCGPVGAHGQSSCGKCLSVTNTGTGAKTTVRIVDQCSNGGLDLDVNVFRQLDTDGKGYERGHITVNYQFVDCGDSFNPLFSVMKSSVIN
Research Area others
Source E.coli
Gene Names HEV1
Protein Names Major hevein
Expression Region 18-204aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 24.1 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function N-acetyl-D-glucosamine / N-acetyl-D-neuraminic acid binding lectin. Can inhibit fungal growth.
Tissue Specificity Laticifer.

Related Products

HEV1 Antibodies

HEV1 Antibodies for Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

HEV1 Proteins

HEV1 Proteins for Hevea brasiliensis (Para rubber tree) (Siphonia brasiliensis)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.