Recombinant Human CTP synthase 1 (CTPS1)

Code CSB-YP006176HU
Abbreviation Recombinant Human CTPS1 protein
MSDS
Size $276
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
CTPS1; CTPS; CTP synthase 1; EC 6.3.4.2; CTP synthetase 1; UTP--ammonia ligase 1
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
1-591aa
Target Protein Sequence
MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
68.7kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The intact gene sequence encoding the human CTP synthase 1 (CTPS1) is expressed in the yeast. The resulting protein is fused with the 6xHis-tag to generate the recombinant human CTPS1 protein. Its purity reaches up to 90% measured by SDS-PAGE. On the gel, this recombinant CTPS1 protein migrated to the molecular weight band of about 70 kDa. The observed molecular weight is a little greater than the theoretical value due to the galactosylated modification. The target protein CTPS1 catalyzes the rate-limiting step in the de novo synthesis of CTP. It is important for the expansion of activated T cells. In T lymphocytes, CTPS1 expression is upregulated in response to TCR stimulation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Can you help me out with the following questions:
1. The above has been purified by his tag and then dialysed? Or a different way?
2. Have you tested (or could you test activity)

A:
Thanks for your inquiry. The protein information is as follow:
1)The tag of this protein is N-terminal 6xHis-tagged, and we purify through his-tag.
2)We haven't tested the activity of this protein yet so we can't 100% guarantee that it is active. The protein is purified under mild conditions, which should have activity in theory. Here is a link for reference. https://europepmc.org/articles/PMC1400552;jsessionid=EF3A6F1F8903A542A07957B8594C1A8A
It shows phosphorylation is more important for this protein, and yeast expression protein is active. You can refer to it.
Q:

Is this protein active?

A:

We haven't tested its activity, its activity is not guaranteed. This is a full length protein and we adopt affinity chromatography for purification, which is purified under a very mild condition. Besides, some customers reordered this protein several times, it's very likely to be active.
https://europepmc.org/articles/PMC1400552
According to this article, hosphorylation modification is important for this CTPS1 protein, and the one expressed in yeast is active.

Target Background

Function
This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
Gene References into Functions
  1. CTP synthase forms the cytoophidium in human hepatocellular carcinoma. PMID: 29097181
  2. The filament structures elucidate allosteric mechanisms of assembly and regulation that rely on a conserved conformational equilibrium. The findings may provide a mechanism for increasing human CTP synthase activity in response to metabolic state and challenge the assumption that metabolic filaments are generally storage forms of inactive enzymes. PMID: 28459447
  3. Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings. PMID: 24477477
  4. results highlight a key and specific role of CTPS1 in the immune system by its capacity to sustain the proliferation of activated lymphocytes during the immune response PMID: 24870241
  5. analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation PMID: 20739275
  6. CTP synthetase is phosphorylated by protein kinase A PMID: 16179339
  7. Data indicate that protein kinase C phosphorylation at Ser(462) stimulates human CTP synthetase 1 activity, whereas phosphorylation at Thr(455) inhibits activity. PMID: 17463002
  8. analysis of phosphorylation and regulation of human CTPS1 in human cells shows that GSK3 is a novel regulator of CTPS activity PMID: 17681942
  9. studies provide novel information on the potential interacting proteins that may regulate CTPS1 function or intracellular localization PMID: 18600551

Show More

Hide All

Involvement in disease
Immunodeficiency 24 (IMD24)
Subcellular Location
Cytoplasm, cytosol.
Protein Families
CTP synthase family
Tissue Specificity
Widely expressed.
Database Links

HGNC: 2519

OMIM: 123860

KEGG: hsa:1503

STRING: 9606.ENSP00000361699

UniGene: Hs.473087

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*