Recombinant Human CTP synthase 1(CTPS1)

Code CSB-YP006176HU
Product Type Recombinant Protein
Size US$2010
Uniprot No. P17812
Relevance This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Tris-based buffer,50% glycerol
Alias CTP synthetase 1 UTP--ammonia ligase 1
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Research Area Signal Transduction
Source Yeast
Gene Names CTPS1
Protein Names Recommended name: CTP synthase 1 EC= 6.3.4.2 Alternative name(s): CTP synthetase 1 UTP--ammonia ligase 1
Expression Region 1-591aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 68.7kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.
Involvement in disease Immunodeficiency 24 (IMD24)
Protein Families CTP synthase family
Tissue Specificity Widely expressed.
Database Links

HGNC: 2519

OMIM: 123860

KEGG: hsa:1503

STRING: 9606.ENSP00000361699

UniGene: Hs.473087

Q&A and Customer Reviews

Q&A
Q:

Can you help me out with the following questions:
1. The above has been purified by his tag and then dialysed? Or a different way?
2. Have you tested (or could you test activity)

A:
Thanks for your inquiry. The protein information is as follow:
1)The tag of this protein is N-terminal 6xHis-tagged, and we purify through his-tag.
2)We haven't tested the activity of this protein yet so we can't 100% guarantee that it is active. The protein is purified under mild conditions, which should have activity in theory. Here is a link for reference. https://europepmc.org/articles/PMC1400552;jsessionid=EF3A6F1F8903A542A07957B8594C1A8A
It shows phosphorylation is more important for this protein, and yeast expression protein is active. You can refer to it.
Customer Reviews

Related Products

CTPS1 Antibodies

CTPS1 Antibodies for Homo sapiens (Human)

CTPS1 Antibodies for Human

CTPS1 Proteins

CTPS1 Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.