Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CTPS1

Uniprot No.

P17812

Research Area

Signal Transduction

Alternative Names

CTPS1; CTPS; CTP synthase 1; EC 6.3.4.2; CTP synthetase 1; UTP--ammonia ligase 1

Species

Homo sapiens (Human)

Source

Yeast

Expression Region

1-591aa

Target Protein Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLDLGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEPQVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLSPDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRKMLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEEPVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDANSTEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKKCLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCRLSPRDTYSDRSGSSSPDSEITELKFPSINHD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

68.7kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The intact gene sequence encoding the human CTP synthase 1 (CTPS1) is expressed in the yeast. The resulting protein is fused with the 6xHis-tag to generate the recombinant human CTPS1 protein. Its purity reaches up to 90% measured by SDS-PAGE. On the gel, this recombinant CTPS1 protein migrated to the molecular weight band of about 70 kDa. The observed molecular weight is a little greater than the theoretical value due to the galactosylated modification. The target protein CTPS1 catalyzes the rate-limiting step in the de novo synthesis of CTP. It is important for the expansion of activated T cells. In T lymphocytes, CTPS1 expression is upregulated in response to TCR stimulation.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

Can you help me out with the following questions:
1. The above has been purified by his tag and then dialysed? Or a different way?
2. Have you tested (or could you test activity)

Thanks for your inquiry. The protein information is as follow:
1）The tag of this protein is N-terminal 6xHis-tagged, and we purify through his-tag.
2）We haven't tested the activity of this protein yet so we can't 100% guarantee that it is active. The protein is purified under mild conditions, which should have activity in theory. Here is a link for reference. https://europepmc.org/articles/PMC1400552;jsessionid=EF3A6F1F8903A542A07957B8594C1A8A
It shows phosphorylation is more important for this protein, and yeast expression protein is active. You can refer to it.

Target Background

Function

This enzyme is involved in the de novo synthesis of CTP, a precursor of DNA, RNA and phospholipids. Catalyzes the ATP-dependent amination of UTP to CTP with either L-glutamine or ammonia as a source of nitrogen. This enzyme and its product, CTP, play a crucial role in the proliferation of activated lymphocytes and therefore in immunity.

Gene References into Functions

CTP synthase forms the cytoophidium in human hepatocellular carcinoma. PMID: 29097181
The filament structures elucidate allosteric mechanisms of assembly and regulation that rely on a conserved conformational equilibrium. The findings may provide a mechanism for increasing human CTP synthase activity in response to metabolic state and challenge the assumption that metabolic filaments are generally storage forms of inactive enzymes. PMID: 28459447
Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings. PMID: 24477477
results highlight a key and specific role of CTPS1 in the immune system by its capacity to sustain the proliferation of activated lymphocytes during the immune response PMID: 24870241
analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation PMID: 20739275
CTP synthetase is phosphorylated by protein kinase A PMID: 16179339
Data indicate that protein kinase C phosphorylation at Ser(462) stimulates human CTP synthetase 1 activity, whereas phosphorylation at Thr(455) inhibits activity. PMID: 17463002
analysis of phosphorylation and regulation of human CTPS1 in human cells shows that GSK3 is a novel regulator of CTPS activity PMID: 17681942
studies provide novel information on the potential interacting proteins that may regulate CTPS1 function or intracellular localization PMID: 18600551

Hide All

Involvement in disease

Immunodeficiency 24 (IMD24)

Subcellular Location

Cytoplasm, cytosol.

Protein Families

CTP synthase family

Tissue Specificity

Widely expressed.

Database Links

HGNC: 2519

OMIM: 123860

KEGG: hsa:1503

STRING: 9606.ENSP00000361699

UniGene: Hs.473087

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address