Recombinant Horse Serum amyloid A protein(SAA1)

Code CSB-EP020656HO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P19857
Relevance Major acute phase reactant. Apolipoprotein of the HDL complex.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Amyloid fibril protein AA
Species Equus caballus (Horse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence LLSFLGEAARGTWDMIRAYNDMREANYIGADKYFHARGNYDAAKRGPGGAWAAKVISDARENFQRFTDRFSFGGSGRGAEDSRADQAANEWGRSGKDPNHFRPHGLPDKY
Research Area Others
Source E.coli
Gene Names SAA1
Expression Region 1-110aa
Tag Info N-terminal 6xHis-tagged
Mol. Weight 16.3kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Major acute phase reactant. Apolipoprotein of the HDL complex.
Involvement in disease Reactive, secondary amyloidosis is characterized by the extracellular accumulation in various tissues of the SAA protein. These deposits are highly insoluble and resistant to proteolysis; they disrupt tissue structure and compromise function.
Protein Families SAA family
Tissue Specificity Expressed by the liver; secreted in plasma.
Database Links

STRING: 9796.ENSECAP00000011472

UniGene: Eca.18017

Related Products

SAA1 Antibodies

SAA1 Antibodies for Equus caballus (Horse)

SAA1 Proteins

SAA1 Proteins for Equus caballus (Horse)

SAA1 ELISA Kit

SAA1 ELISA Kit for Equus caballus (Horse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.