Recombinant Hottentotta judaicus Alpha-insect toxin BjaIT


In Stock
Code CSB-EP690933BOA
Product Type Recombinant Protein
Size EP: USD786
Uniprot No. Q56TT9
Storage Buffer Tris-based buffer,50% glycerol
Species Hottentotta judaicus(Black scorpion)(Buthotus judaicus)
Purity Greater than 85% as determined by SDS-PAGE.
Sequence GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR
Research Area Others
Source E.coli
Gene Names N/A
Protein Names Recommended name: Alpha-insect toxin BjaITAlternative name(s): Bj-alpha-IT
Expression Region 20-83aa
Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
Mol. Weight 14.4 kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds voltage-dependently at site-3 of sodium channels and inhibits the inactivation of the activated channels, thereby blocking neuronal transmission. This toxin is active against insects (para/tipE).
Subcellular Location Secreted
Protein Families Long (4 C-C) scorpion toxin superfamily, Sodium channel inhibitor family, Alpha subfamily
Tissue Specificity Expressed by the venom gland.

Related Products

N/A Proteins

N/A Proteins for Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.