Recombinant Human Nucleoside diphosphate kinase B (NME2), partial

In Stock
Code CSB-EP015886HU
Abbreviation Recombinant Human NME2 protein, partial
MSDS
Size US$256
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
NME2
Uniprot No.
Research Area
Neuroscience
Alternative Names
C myc purine binding transcription factor PUF; C myc transcription factor; C-myc purine-binding transcription factor PUF; epididymis secretory sperm binding protein Li 155an; HEL-S-155an; Histidine protein kinase NDKB; MGC111212; MGC2212; NDK B; NDKB; NDKB_HUMAN; NDP kinase B; NDPK B; NDPKB; NM23 H2; nm23-H2; NM23B; NME/NM23 nucleoside diphosphate kinase 2; nme2; Non metastatic cells 2; protein (NM23B) expressed in; non-metastatic cells 2; protein (NM23) expressed in; Nucleoside diphosphate kinase B; Nucleotide diphosphate kinase B; PUF
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-152aa
Target Protein Sequence
ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
24.2 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This Human NME2 recombinant protein was produced in E.coli, where the gene sequence encoding Human NME2 (2-152aa) was expressed with the N-terminal 10xHis tag and C-terminal Myc tag. The purity of this NME2 protein was greater than 85% by SDS-PAGE.
NME2 is an enzyme that catalyzes the phosphorylation of nucleoside monophosphates, converting them into nucleoside diphosphates. This is an important biochemical process involved in cellular energy metabolism and nucleotide synthesis. NME2 plays a critical role in various cellular biological processes. It is involved in DNA synthesis, RNA synthesis, cell cycle regulation, and cell signal transduction. Additionally, NME2 is associated with cellular antioxidant defense and apoptosis. Furthermore, NME2 is of significant interest in cancer biology. Some studies suggest that NME2 plays a role in tumor suppression as it can regulate the cell cycle and apoptosis. Therefore, abnormal expression of NME2 is associated with the development and progression of various cancers, including breast cancer and prostate cancer.

Customer Reviews and Q&A

 Customer Reviews
Average Rating:
5.0 - 1 reviews

Submit a Review here

Applications : /

Review: For the biosensor containing the imprinted layer of PDA,correspond to the morphology of the biosensor containing the template molecule NDKB protein and after the removal of NDKB, respectively.

By Anonymous

Target Background

Function
Major role in the synthesis of nucleoside triphosphates other than ATP. The ATP gamma phosphate is transferred to the NDP beta phosphate via a ping-pong mechanism, using a phosphorylated active-site intermediate. Negatively regulates Rho activity by interacting with AKAP13/LBC. Acts as a transcriptional activator of the MYC gene; binds DNA non-specifically. Binds to both single-stranded guanine- and cytosine-rich strands within the nuclease hypersensitive element (NHE) III(1) region of the MYC gene promoter. Does not bind to duplex NHE III(1). Has G-quadruplex (G4) DNA-binding activity, which is independent of its nucleotide-binding and kinase activity. Binds both folded and unfolded G4 with similar low nanomolar affinities. Stabilizes folded G4s regardless of whether they are prefolded or not. Exhibits histidine protein kinase activity.
Gene References into Functions
  1. Data suggest that NME2 participates in epigenetic repression of TERT expression via a mechanism that is dependent on interactions with G-quadruplex DNA; NME2 appears to interact with TERT promoter as NME2/REST/LSD1 complex. (NME2 = metastasis suppressor protein 2; TERT = telomerase reverse transcriptase; REST = RE1-silencing transcription factor; LSD1 = lysine specific demethylase 1) PMID: 28717007
  2. Role of Interaction and Nucleoside Diphosphate Kinase B in Regulation of the Cystic Fibrosis Transmembrane Conductance Regulator Function by cAMP-Dependent Protein Kinase A PMID: 26950439
  3. NME2 may have an inhibitory activity on the propagation and invasion of gastric cancer cells. PMID: 25700270
  4. Regulatory functions of Nm23-H2 in tumorigenesis: insights from biochemical to clinical perspectives PMID: 25413836
  5. Recent findings demonstrate NME2 presence at telomere ends, association with telomerase, and NME2's role in inhibition of telomerase activity in cancer cells PMID: 25547372
  6. A novel mechanism of CARMA3 in lung cancer stemness and metastasis through the negative regulation of NME2 was identified. PMID: 25906011
  7. NDPK-B and NDPK-D were shown to bind efficiently to liposomes mimicking plasma membrane and mitochondrial inner membrane PMID: 25010650
  8. Patients whose MPM tissues expressed elevated mRNA levels of BIRC5, DSP, NME2, and THBS2 showed a statistically significant shorter overall survival. PMID: 25771974
  9. The results demonstrate that reduced NME2 levels lead to transcriptional de-repression of vinculin and regulate lung cancer metastasis. PMID: 25249619
  10. nucleoside diphosphate kinase B (NDPK-B), activates TRPV5 channel activity and Ca(2+) flux, and this activation requires histidine 711 in the carboxy-terminal tail of TRPV5. PMID: 24523290
  11. NDPKB is required for VEGF-induced angiogenesis and contributes to the correct localization of VEGF receptor type 2 and VE-cadherin at the endothelial adherens junctions. PMID: 25147336
  12. PuF may regulate the APP gene promoter PMID: 23368879
  13. post-transcriptional up-regulation of the tumor antigen NME2 is a common and specific property of CML closely associated with Bcr-Abl activity PMID: 22251158
  14. NM23-H2 expression enhances tumorigenicity. PMID: 22192927
  15. further demonstrate that shNDPK-B is released into the circulation in immunocompromized mice carrying the human breast carcinoma cell MDA-MB- PMID: 20830314
  16. Observational study of gene-disease association, gene-gene interaction, and genetic testing. (HuGE Navigator) PMID: 20864512
  17. NM23-H2 protein expression in human leukemia cell lines is related to cellular lineage and differentiation stages. PMID: 12007505
  18. The nucleotide-binding site of NM23-H2 plays a critical role in not only the NDP kinase reaction but also the reactions involving covalent DNA binding and DNA cleavage catalysis. PMID: 12009894
  19. Nm23-H2 had a cytoplasmic and nuclear localization but was induced to translocate to the plasma membrane upon stimulation of thromboxane A2 receptor beta to show extensive co-localization with the receptor. PMID: 14976202
  20. novel association of NM23-H2 with ERbeta and show for the first time its expression in vascular cells and demonstrate regulation of its expression and localization by estrogen PMID: 17272673
  21. Thus, these results indicate the existence of a previously undiscovered mechanism by which NM23-H2 involves in the regulation of Diva-mediated apoptosis. PMID: 17532299
  22. NM23-H2 as an estrogen receptor beta-associated protein may play an important role in modulating the response to endogenous and exogenous estrogens. PMID: 17964137
  23. describe the identification of NM23-H2 as a novel HLA-A32-restricted TAA of CML cells and demonstrate the presence of specifically reactive T cells in a patient 5 years after transplantation PMID: 18496563
  24. While hPLIC proteins are not ubiquitinated by HERC3, HERC5 plays an important role in ubiquitination of Nm23B. PMID: 18535780
  25. data indicate that NM23H2 is a negative regulator of cellular proliferation stimulated by EGF- and Ras-mediated activation of the ERK pathway PMID: 19022560
  26. Role of NM23-H2 in the regulation of cell shape and migration via Rho family GTPase signals is reported. PMID: 19381785
  27. Data support the hypothesis that exogenous pDNA binds to cytoplasmic shuttle proteins NM23-H2 and Chx10, and is then translocated to the nucleus using the minimal import machinery. PMID: 19638341

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Cell projection, lamellipodium. Cell projection, ruffle.
Protein Families
NDK family
Tissue Specificity
Isoform 1 and isoform 3 are ubiquitously expressed.
Database Links

HGNC: 7850

OMIM: 156491

KEGG: hsa:4831

STRING: 9606.ENSP00000376886

UniGene: Hs.463456

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*