Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Neuroscience
Alternative Names
C myc purine binding transcription factor PUF; C myc transcription factor; C-myc purine-binding transcription factor PUF; epididymis secretory sperm binding protein Li 155an; HEL-S-155an; Histidine protein kinase NDKB; MGC111212; MGC2212; NDK B; NDKB; NDKB_HUMAN; NDP kinase B; NDPK B; NDPKB; NM23 H2; nm23-H2; NM23B; NME/NM23 nucleoside diphosphate kinase 2; nme2; Non metastatic cells 2; protein (NM23B) expressed in; non-metastatic cells 2; protein (NM23) expressed in; Nucleoside diphosphate kinase B; Nucleotide diphosphate kinase B; PUF
Species
Homo sapiens (Human)
Expression Region
2-152aa
Target Protein Sequence
ANLERTFIAIKPDGVQRGLVGEIIKRFEQKGFRLVAMKFLRASEEHLKQHYIDLKDRPFFPGLVKYMNSGPVVAMVWEGLNVVKTGRVMLGETNPADSKPGTIRGDFCIQVGRNIIHGSDSVKSAEKEISLWFKPEELVDYKSCAHDWVYE
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
This Human NME2 recombinant protein was produced in E.coli, where the gene sequence encoding Human NME2 (2-152aa) was expressed with the N-terminal 10xHis tag and C-terminal Myc tag. The purity of this NME2 protein was greater than 85% by SDS-PAGE.
NME2 is an enzyme that catalyzes the phosphorylation of nucleoside monophosphates, converting them into nucleoside diphosphates. This is an important biochemical process involved in cellular energy metabolism and nucleotide synthesis. NME2 plays a critical role in various cellular biological processes. It is involved in DNA synthesis, RNA synthesis, cell cycle regulation, and cell signal transduction. Additionally, NME2 is associated with cellular antioxidant defense and apoptosis. Furthermore, NME2 is of significant interest in cancer biology. Some studies suggest that NME2 plays a role in tumor suppression as it can regulate the cell cycle and apoptosis. Therefore, abnormal expression of NME2 is associated with the development and progression of various cancers, including breast cancer and prostate cancer.