Recombinant Human 1-acylglycerol-3-phosphate O-acyltransferase PNPLA3 (PNPLA3), partial

Code CSB-EP889106HU
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
PNPLA3
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(Acylglycerol transacylase)(Adiponutrin)(ADPN)(Calcium-independent phospholipase A2-epsilon)(iPLA2-epsilon)(Lysophosphatidic acid acyltransferase)(Patatin-like phospholipase domain-containing protein 3)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
63-481aa
Target Protein Sequence
EQTLQVLSDLVRKARSRNIGIFHPSFNLSKFLRQGLCKCLPANVHQLISGKIGISLTRVSDGENVLVSDFRSKDEVVDALVCSCFIPFYSGLIPPSFRGVRYVDGGVSDNVPFIDAKTTITVSPFYGEYDICPKVKSTNFLHVDITKLSLRLCTGNLYLLSRAFVPPDLKVLGEICLRGYLDAFRFLEEKGICNRPQPGLKSSSEGMDPEVAMPSWANMSLDSSPESAALAVRLEGDELLDHLRLSILPWDESILDTLSPRLATALSEEMKDKGGYMSKICNLLPIRIMSYVMLPCTLPVESAIAIVQRLVTWLPDMPDDVLWLQWVTSQVFTRVLMCLLPASRSQMPVSSQQASPCTPEQDWPCWTPCSPKGCPAETKAEATPRSILRSSLNFFLGNKVPAGAEGLSTFPSFSLEKSL
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
53.7 kDa
Protein Length
Partial
Tag Info
N-terminal 10xHis-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Specifically catalyzes coenzyme A (CoA)-dependent acylation of 1-acyl-sn-glycerol 3-phosphate (2-lysophosphatidic acid/LPA) to generate phosphatidic acid (PA), an important metabolic intermediate and precursor for both triglycerides and glycerophospholipids. Does not esterify other lysophospholipids. Acyl donors are long chain (at least C16) fatty acyl-CoAs: arachidonoyl-CoA, linoleoyl-CoA, oleoyl-CoA and at a lesser extent palmitoyl-CoA. Additionally possesses low triacylglycerol lipase and CoA-independent acylglycerol transacylase activities and thus may play a role in acyl-chain remodeling of triglycerides. Has hydrolytic activity against glycerolipids triacylglycerol, diacylglycerol and monoacylglycerol, with a strong preference for oleic acid as the acyl moiety.
Gene References into Functions
  1. Intergroup comparisons showed that the severe grade of hepatic steatosis was more frequently observed in GG than in CC carriers (74% vs. 11.3%, p < 0.001, OR 21.8). PNPLA3 CG and GG carriers with CD have a higher susceptibility to hepatic steatosis, but not to metabolic syndrome. Moreover, patients with GG alleles display more severe forms of HS based on ultrasound. PMID: 30189691
  2. The unaltered proportion of DAG (FA18:1) in I148M PNPLA3 carriers with fatty liver may explain the normal insulin sensitivity in these subjects. PMID: 30227635
  3. PNPLA3 polymorphisms were associated with advanced liver fibrosis in patients with HCV mono-Infection and HCV/HIV Co-Infection. PMID: 30139224
  4. In this longitudinal study with liver biopsy to stage liver fibrosis, we affirm there is no influence of the PNPLA3 rs738409 (GG) genotype on the occurrence of hepatocellular carcinoma in Asian chronic hepatitis C patients, including cirrhotic patients. PMID: 29089161
  5. The authors results demonstrate that SNP in the PNPLA3 gene is significantly associated with the presence and severity of NAFLD in a Korean populations. PMID: 29271184
  6. case-control study confirmed that PNPLA3 rs738409 Single Nucleotide Polymorphism is associated with Alcoholic Liver Disease. PMID: 29474507
  7. These data indicate that the liver expression of the PNPLA3 p.148M variant confers a genetic predisposition to liver graft steatosis along with nutritional status and diabetes. PMID: 29396131
  8. Findings suggest a significant association between variants in COL13A1, ADIPOQ, SAMM50, and PNPLA3, and risk of NAFLD/elevated transaminase levels in Mexican adults with an admixed ancestry. PMID: 29307798
  9. PNPLA3 determines the risk of NASH and significant fibrosis. PMID: 29193269
  10. Our study suggested that PNPLA3 loci (rs2294918, rs2294919) were associated with HBV-related HCC in Han Chinese. PMID: 28617615
  11. In this Sri Lankan community cohort study, the annual incidence of non-alcoholic fatty liver disease (NAFLD) was 6.2%. Incident NAFLD was associated with general and central obesity, raised triglycerides and diabetes, and showed a tendency of association with PNPLA3 gene polymorphisms. PMID: 28544258
  12. Although no single variant reached genome-wide significance, an association signal was observed for PNPLA3 rs738409, a common single nucleotide polymorphism that has been associated with a variety of liver-related pathologies including alcoholic cirrhosis. This preliminary analysis suggests a role for PNPLA3 variation and several gene sets/pathways that may influence risk for alcoholic hepatitis among heavy drinkers. PMID: 28776448
  13. rs738409 polymorphism was not associated with premature coronary artery disease in the whole group of participants, however, when patients and controls were divided into those with and without type 2 diabetes mellitus patients, under additive model, the polymorphism was associated with the presence of coronary artery disease only in patients with type 2 diabetes mellitus patients PMID: 27615511
  14. These findings suggest that PNPLA3 rs1010023 may predispose chronic hepatitis B patients to hepatic steatosis but protects them from glucose dysregulation by attenuating insulin resistance. PMID: 28695131
  15. Its genotype showes an association with NAFLD, NASH, fibrosis, and cirrhosis. PMID: 28975533
  16. Individuals misusing alcohol who carry a particular variant of the gene PNPLA3 are more at risk of developing severe alcoholic hepatitis. PMID: 28161471
  17. PNPLA3 is the first locus to be reproducibly and strongly associated with steatosis, fibrosis/cirrhosis in various liver diseases with different etiologies and even HCC in fatty liver diseases. PMID: 29364097
  18. The associations between PNPLA3 rs738409 GG genotype and steatosis was significant and was associated to advanced fibrosis. PMID: 29258449
  19. Two single nucleotide polymorphisms (SNPs), rs430397 in glucose regulated protein 78 kDa (GRP78) and rs738409 in patatin-like phospholipase domain-containing 3 protein (PNPLA3), were shown to be significantly associated with the risk of developing hepatocellular carcinoma (HCC) in a Sicilian population. PMID: 27888630
  20. Meta-analysis provided strong and unequivocal evidence for a significant role for rs738409 in PNPLA3 in the progression of Alcohol-related Cirrhosis with effect sizes in the range expected for a relatively frequent single nuclear polymorphism in a complex disease. PMID: 27575312
  21. PNPLA3 SNP I148M occurs with high frequency in Mexican population and favors development of NAFLD. PMID: 29055919
  22. Overall, we showed that novel variants in PNPLA3 are very rare in our liver biopsy cohort, thereby indicating that their impact on the etiology of nonalcoholic fatty liver disease is probably limited. Nevertheless, for the three rare coding variants that were identified in patients with advanced liver disease, further functional characterization will be essential to verify their potential disease causality. PMID: 27288299
  23. PNPLA3 GG genotype was elevated in aggressive disease phenotype of non-alcoholic fatty liver disease. PMID: 28626169
  24. PNPLA3 was strongly expressed in the liver and clearly detectable in subcutaneous adipose tissue of obese patients. Weight loss induced by Laparoscopic gastric banding (LAGB) of severely obese patients led to significantly increased adipose, but not hepatic, tissue expression of PNPLA3. Weight loss induced by LAGB restored adipose tissue PNPLA3 expression which is suppressed by tumour necrosis factor alpha. PMID: 27514759
  25. Our study suggests that the pathogenic role of PNPLA3(148M) in nonalcoholic fatty liver disease is independent of the gene transcription in humans, which may be attributed to the high endogenous transcription level of PNPLA3 gene in human livers. PMID: 27744419
  26. The association between the PNPLA3 variant and bipolar disorder may help guide further work on medication effectiveness, treatment options, prevention approaches, and understanding potential medication side effects among specific subgroups of individuals with the MM genotype. PMID: 27889599
  27. The PNPLA3 rs738409 GG genotype is positively associated with hepatic steatosis in Asian patients with chronic hepatitis C. PMID: 28797039
  28. 148M isoform accumulates on lipid drplets when expressed in the livers of mice PMID: 28520213
  29. The study proposes that polymorphisms in the PNPLA3 gene have highly predictive value in the development of nonalcoholic fatty liver disease and are independently associated with the severity of liver histology in patients with NAFLD. PMID: 28253210
  30. PNPLA3 association with adiposity and the risk of the nonalcoholic fatty liver disease PMID: 28436986
  31. PNPLA3 gene variant is associated with the risk of developing liver fibrosis and cirrhosis in an Eastern European population. PMID: 28338112
  32. PNPLA3 acts as a positive modulator of activated human hepatic stellate cells, affecting cytokines secretion. PMID: 28073161
  33. The results show that in obese patients, the presence of the PNPLA3 p.I148M allele might be associated with greater improvement of hepatic steatosis after bariatric surgery in comparison to carriers of PNPLA3 wild-type alleles. The also lost more weight and had reduced liver fat content. PMID: 27576208
  34. PNPLA3 rs738409 (C>G) was associated with the risk of both advanced liver fibrosis and steatosis in patients with chronic hepatitis C, especially among Caucasian populations PMID: 26419236
  35. we provide evidence to indicate that PNPLA3-mediated retinol release may protect against liver fibrosis by inducing a specific signature of proteins involved in extracellular matrix remodelling PMID: 27742777
  36. The percentage of the PNPLA3 rs738409 GG genotype in NAFLD patients was also significantly higher than that in the controls. PMID: 27059980
  37. the rs738409 polymorphism in PNPLA3 is associated with liver fibrosis progression in HIV/HCV-coinfected patients PMID: 27973562
  38. Lean non-alcoholic fatty liver disease subjects had a higher rate of the mutant PNPLA3 CG/GG variant compared to lean controls. PMID: 27527746
  39. The results that in Japanese patients with NAFLD PNPLA3 genotype had some affect on the histological features, including stage of fibrosis. PMID: 26610348
  40. This is the first study to report the interaction between the PNPLA3 rs738409 polymorphism and physical activity or sedentary behavior on Non-Alcoholic Fatty Liver Disease, providing new clues on the function of the PNPLA3 gene PMID: 27905898
  41. Data show that the alleles of PNPLA3 locus with differential distribution in cohorts with non-alcoholic fatty liver disease, non-alcoholic steatohepatitis (NASH) and pericellular fibrosis. Heterozygosity at this locus is independently associated with higher risk of having NASH and pericellular fibrosis. PMID: 27596100
  42. In NAFLD patients, carriage of the PNPLA3G allele, and particularly of the GG genotype, is significantly associated with the risk of cirrhotic evolution PMID: 27150500
  43. The hepatic copper content and PNPLA3 mutations are associated with disease activity in NAFLD patients without MetS. Presence of MetS appears to mask the effects of hepatic copper and PNPLA3. PMID: 27908400
  44. Regarding rs738409 polymorphism, GG genotype was positive correlated with the presence of non-alcoholic steatohepatitis. PMID: 27128907
  45. SNPs rs2896019 and rs3810622 significantly associated with increased risk of nonalcoholic fatty liver disease in Han Chinese population PMID: 27537584
  46. The PNPLA3 148 I/M or M/M variants and CD4(+) cell count were the only independent predictors of severe steatosis in patients with hepatitis C virus non-3 genotypes. PMID: 26806136
  47. the PNPLA3 rs738409 was determined to be associated with hepatocellular carcinoma development in a cohort of Japanese patients with type 2 diabetes mellitus PMID: 26337813
  48. PNPLA3 p.I148M variant represents the most important prosteatotic genetic risk factor. NAFLD carriers of this variant should be followed up carefully, with elastography being ideally suited for this purpose. PMID: 26264356
  49. The PNPLA3 p.I148M variant is associated with non-alcoholic fatty liver disease. PMID: 26745555
  50. based on data from the HALT-C trial, the PNPLA3 CG/GG SNP at rs738409 is associated with fibrosis progression but not development of Hepatocellular Carcinoma in patients with Hepatitis C Virus Infection PMID: 26305067

Show More

Hide All

Involvement in disease
Non-alcoholic fatty liver disease 1 (NAFLD1)
Subcellular Location
Membrane; Single-pass type II membrane protein. Lipid droplet.
Database Links

HGNC: 18590

OMIM: 609567

KEGG: hsa:80339

STRING: 9606.ENSP00000216180

UniGene: Hs.654800

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*