Recombinant Human 5-formyltetrahydrofolate cyclo-ligase(MTHFS)

Code CSB-EP015159HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P49914
Relevance Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias 5,10-methenyl-tetrahydrofolate synthetase ;MTHFS ;Methenyl-THF synthetase
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
Research Area Metabolism
Source E.coli
Gene Names MTHFS
Protein Names Recommended name: 5-formyltetrahydrofolate cyclo-ligase EC= 6.3.3.2 Alternative name(s): 5,10-methenyl-tetrahydrofolate synthetase Short name= MTHFS Short name= Methenyl-THF synthetase
Expression Region 2-203aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 39.1kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
Subcellular Location Cytoplasm
Protein Families 5-formyltetrahydrofolate cyclo-ligase family
Database Links

HGNC: 7437

OMIM: 604197

KEGG: hsa:10588

STRING: 9606.ENSP00000258874

UniGene: Hs.194294

Related Products

MTHFS Antibodies

MTHFS Antibodies for Homo sapiens (Human)

MTHFS Antibodies for Human

MTHFS Proteins

MTHFS Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.