Recombinant Human A-kinase anchor protein 4 (AKAP4)

In Stock
Code CSB-EP702494HU
Abbreviation Recombinant Human AKAP4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AKAP4
Uniprot No.
Research Area
Signal Transduction
Alternative Names
A kinase (PRKA) anchor protein 4; A kinase anchor protein 4; A kinase anchor protein 82 kDa; A-kinase anchor protein 4; A-kinase anchor protein 82 kDa; AKAP 4; AKAP 82; AKAP-4; AKAP4; AKAP4_HUMAN; AKAP82; FSC 1; FSC1; hAKAP 82; hAKAP82; HI; Major sperm fibrous sheath protein; p82; PRKA 4; PRKA4; Protein kinase A anchoring protein 4; Protein kinase A-anchoring protein 4; Testis specific gene HI
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
189-854aa
Target Protein Sequence
QSPSAPPAKPPSTQRAVISPDGECSIDDLSFYVNRLSSLVIQMAHKEIKEKLEGKSKCLHHSICPSPGNKERISPRTPASKIASEMAYEAVELTAAEMRGTGEESREGGQKSFLYSELSNKSKSGDKQMSQRESKEFADSISKGLMVYANQVASDMMVSLMKTLKVHSSGKPIPASVVLKRVLLRHTKEIVSDLIDSCMKNLHNITGVLMTDSDFVSAVKRNLFNQWKQNATDIMEAMLKRLVSALIGEEKETKSQSLSYASLKAGSHDPKCRNQSLEFSTMKAEMKERDKGKMKSDPCKSLTSAEKVGEHILKEGLTIWNQKQGNSCKVATKACSNKDEKGEKINASTDSLAKDLIVSALKLIQYHLTQQTKGKDTCEEDCPGSTMGYMAQSTQYEKCGGGQSAKALSVKQLESHRAPGPSTCQKENQHLDSQKMDMSNIVLMLIQKLLNENPFKCEDPCEGENKCSEPRASKAASMSNRSDKAEEQCQEHQELDCTSGMKQANGQFIDKLVESVMKLCLIMAKYSNDGAALAELEEQAASANKPNFRGTRCIHSGAMPQNYQDSLGHEVIVNNQCSTNSLQKQLQAVLQWIAASQFNVPMLYFMGDKDGQLEKLPQVSAKAAEKGYSVGGLLQEVMKFAKERQPDEAVGKVARKQLLDWLLANL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
77.3kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Major structural component of sperm fibrous sheath. Plays a role in sperm motility.
Gene References into Functions
  1. High AKAP4 expression is associated with reduced sperm motility. PMID: 29581387
  2. A significant association was found between AKAP4 gene expression and metastasis (P-value: 0.045), expression of the CTAG1B (NY-ESO-1) gene was not observed in our cases. PMID: 29480665
  3. the physiological role of the negative crosstalk between the cAMP/PKA/AKAP4 and the PKC/ERK1/2 pathways is to regulate capacitation and acrosome reaction. PMID: 27901058
  4. AKAP4 role in the proliferation and metastasis of thyroid cancer.AKAP4 is highly expressed in thyroid cancer. PMID: 27983916
  5. AKAP4 appears to be a novel Colorectal cancer-associated antigen with a potential for developing as a new clinical therapeutic target PMID: 26590805
  6. AKAP4 is a highly accurate biomarker for the detection of early stage lung cancer. PMID: 26160834
  7. SP17/AKAP4/PTTG1 are expressed in both human NSCLC cell lines and primary tumors and can elicit an immunogenic response in lung cancer patients. PMID: 25739119
  8. The putative role of AKAP4 in early tumorigenesis is implicated as a biomarker and immunotherapeutic target for cervical cancer. PMID: 23478221
  9. Ablation of AKAP4 protein caused significant inhibition in cellular proliferation, colony-forming ability, migration and invasion ability of tumor cells. PMID: 23764900
  10. data suggests that AKAP4 may be used as serum based diagnostic test for an early detection and diagnosis of breast cancer and may be a potential target for immunotherapeutic use PMID: 23451156
  11. We demonstrate the aberrant expression of AKAP-4 in prostate cancer, which will potentially be developed as a biomarker in prostate cancer. PMID: 21520158
  12. AKAP4 is a novel target for protein S-nitrosylation in spermatozoa. PMID: 17683036
  13. Role of AKAP4 in sperm motility is unclear, vut absent or weak AKAP4-labelling is associated with absent or weak sperm. motility. PMID: 17712481

Show More

Hide All

Subcellular Location
Cell projection, cilium, flagellum. Note=Localizes to the principle piece of the sperm flagellum.
Protein Families
AKAP110 family
Tissue Specificity
Testis specific; only expressed in round spermatids.
Database Links

HGNC: 374

OMIM: 300185

KEGG: hsa:8852

STRING: 9606.ENSP00000351327

UniGene: Hs.97633

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*