Recombinant Human Acrosomal protein SP-10 (ACRV1)

In Stock
Code CSB-EP001186HU
Abbreviation Recombinant Human ACRV1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ACRV1
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Acrosomal protein SP 10; Acrosomal protein SP-10; Acrosomal vesicle protein 1; ACRV1; ASPX_HUMAN; D11S4365; Msa63; SP 10; Sp10; SPACA2; Sperm protein 10
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
22-265aa
Target Protein Sequence
QPNELSGSIDHQTSVQQLPGEFFSLENPSDAEALYETSSGLNTLSEHGSSEHGSSKHTVAEHTSGEHAESEHASGEPAATEHAEGEHTVGEQPSGEQPSGEHLSGEQPLSELESGEQPSDEQPSGEHGSGEQPSGEQASGEQPSGEHASGEQASGAPISSTSTGTILNCYTCAYMNDQGKCLRGEGTCITQNSQQCMLKKIFEGGKLQFMVQGCENMCPSMNLFSHGTRMQIICCRNQSFCNKI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
41.8kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human ACRV1 covers amino acids 22-265. The calculated molecular weight for this ACRV1 protein is 41.8 kDa. This protein is generated in a e.coli-based system. The N-terminal 6xHis-SUMO tag was fused into the coding gene segment of ACRV1, making it easier to detect and purify the ACRV1 recombinant protein in the later stages of expression and purification.

Acrosomal protein SP-10 (ACRV1) is primarily associated with research in the field of male reproduction. One of its most crucial research directions involves its function in germ cell development and sperm maturation processes. SP-10 is a key protein during sperm maturation, present in the acrosome of sperm, a structure critical in the fertilization process. Researchers focus on understanding the exact functions of SP-10 in sperm formation, motility, and fertilization to gain insights into its contributions to reproductive health. SP-10 is linked to issues with male fertility, including difficulties in achieving pregnancy and lower fertility rates. This has attracted significant attention in the fields of reproductive medicine and andrology research.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Gene References into Functions
  1. ACRV1 protein was predominantly located in round and elongated spermatids in testes, indicating that ACRV1 may play an important role in mammalian spermatogenesis PMID: 21488928
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome. Note=Nascent acrosomal vesicle of Golgi phase spermatids.
Tissue Specificity
Testis.
Database Links

HGNC: 127

OMIM: 102525

KEGG: hsa:56

STRING: 9606.ENSP00000432816

UniGene: Hs.169222

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*