Recombinant Human Adenine phosphoribosyltransferase(APRT)

Code CSB-EP001954HU
Product Type Recombinant Protein
Size US$1726
Uniprot No. P07741
Relevance Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Homo sapiens (Human)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ADSELQLVEQRIRSFPDFPTPGVVFRDISPVLKDPASFRAAIGLLARHLKATHGGRIDYIAGLDSRGFLFGPSLAQELGLGCVLIRKRGKLPGPTLWASYSLEYGKAELEIQKDALEPGQRVVVVDDLLATGGTMNAACELLGRLQAEVLECVSLVELTSLKGREKLAPVPFFSLLQYE
Research Area Signal Transduction
Source E.coli
Gene Names APRT
Protein Names Recommended name: Adenine phosphoribosyltransferase Short name= APRT EC= 2.4.2.7
Expression Region 1-180aa
Tag Info N-terminal GST-tagged
Mol. Weight 46.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Catalyzes a salvage reaction resulting in the formation of AMP, that is energically less costly than de novo synthesis.
Involvement in disease Adenine phosphoribosyltransferase deficiency (APRTD)
Subcellular Location Cytoplasm
Protein Families Purine/pyrimidine phosphoribosyltransferase family
Database Links

HGNC: 626

OMIM: 102600

KEGG: hsa:353

STRING: 9606.ENSP00000367615

UniGene: Hs.28914

Related Products

APRT Antibodies

APRT Antibodies for Homo sapiens (Human)

APRT Antibodies for Human

APRT Proteins

APRT Proteins for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.