Recombinant Human Aldo-keto reductase family 1 member C1 (AKR1C1)

Code CSB-YP001542HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001542HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP001542HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP001542HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP001542HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
AKR1C1
Uniprot No.
Alternative Names
Aldo-keto reductase family 1 member C1; EC 1.1.1.-; EC 1.1.1.112; EC 1.1.1.209; EC 1.1.1.210; EC 1.1.1.357; EC 1.1.1.51; EC 1.1.1.53; EC 1.1.1.62; EC 1.3.1.20; 20-alpha-hydroxysteroid dehydrogenase; 20-alpha-HSD; EC 1.1.1.149; Chlordecone reductase homolog HAKRC; Dihydrodiol dehydrogenase 1; DD1; High-affinity hepatic bile acid-binding protein; HBAB; AKR1C1 DDH DDH1
Species
Homo sapiens (Human)
Expression Region
1-323
Target Protein Sequence
MDSKYQCVKLNDGHFMPVLGFGTYAPAEVPKSKALEATKLAIEAGFRHIDSAHLYNNEEQVGLAIRSKIADGSVKREDIFYTSKLWCNSHRPELVRPALERSLKNLQLDYVDLYLIHFPVSVKPGEEVIPKDENGKILFDTVDLCATWEAVEKCKDAGLAKSIGVSNFNRRQLEMILNKPGLKYKPVCNQVECHPYFNQRKLLDFCKSKDIVLVAYSALGSHREEPWVDPNSPVLLEDPVLCALAKKHKRTPALIALRYQLQRGVVVLAKSYNEQRIRQNVQVFEFQLTSEEMKAIDGLNRNVRYLTLDIFAGPPNYPFSDEY
Protein Length
Full Length
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cytosolic aldo-keto reductase that catalyzes the NADH and NADPH-dependent reduction of ketosteroids to hydroxysteroids. Most probably acts as a reductase in vivo since the oxidase activity measured in vitro is inhibited by physiological concentrations of NADPH. Displays a broad positional specificity acting on positions 3, 17 and 20 of steroids and regulates the metabolism of hormones like estrogens and androgens. May also reduce conjugated steroids such as 5alpha-dihydrotestosterone sulfate. Displays affinity for bile acids.
Gene References into Functions
  1. AKR1C1 activates STAT3 pathway to promote NSCLC metastasis. PMID: 29344298
  2. Decreased invasion caused by AKR1C1 knockdown suggests a novel role of AKR1C1 in cancer invasion, which is probably due to the regulation of Rac1, Src, or Akt. An inflammatory cytokine, interleukin-1beta, was found to increase AKR1C1 in bladder cancer cell lines. PMID: 27698389
  3. Data show that increased levels of AKR1C1/C2 enhanced the sensitivity of esophageal squamous cell carcinoma (ESCC) cells to ethyl-3,4-dihydroxybenzoate (EDHB). PMID: 26934124
  4. the present study suggests that AKR1C1, AKR1C2, AKR1C3, and AKR1C4 are closely associated with drug resistance to both CDDP and 5FU, and that mefenamic acid, an inhibitor of AKR1C, restores sensitivity through inhibition of drug-resistance in human cancer cells. PMID: 28259989
  5. Activation of AKR1C1/ERbeta induces apoptosis by downregulation of c-FLIP in prostate cancer cells. PMID: 25816367
  6. results suggest a gender-specific modulatory effect of AKR1C1 on anxiety levels, most likely through changes in progesterone and allopregnanolone levels within and outside the brain PMID: 24390875
  7. Studies indicate that mutations in aldo-keto reductase family 1 (AKR1) enzymes AKR1C1 and AKR1C4 are responsible for sexual development dysgenesis and mutations in AKR1D1 are causative in bile-acid deficiency. PMID: 24189185
  8. activation of the Nrf2/AKR1C axis may contribute to oxaliplatin resistance in gastric carcinoma PMID: 23933386
  9. The involvement of up-regulated AKR1C1, AKR1C3 and proteasome in CDDP resistance of colon cancers. PMID: 23165153
  10. Which promoted significant reduction of AKR1C1 and AKR1C2 expression. PMID: 23183084
  11. Data suggest that interleukin-1beta facilitates progesterone metabolism in cervical fibroblasts by regulating expression of AKR1C1 and AKR1C2. PMID: 22064385
  12. It was concluded that the truncated E6 protein of human papillomavirus 16, known as E6*I, has a novel function in upregulating expression of human AKR1C. PMID: 22278827
  13. role of AKR1C1in the metabolism of testosterone and progesterone via the 5beta-reductase pathway. PMID: 21521174
  14. enhanced metabolism of progesterone by SRD5A1 and the 20alpha-HSD and 3alpha/beta-HSD activities of AKR1C1, AKR1C2 and AKR1C3 PMID: 21232532
  15. analysis of single nucleotide polymorphisms of AKR1C1 and AKR1C2 PMID: 21217827
  16. Functionally expressed human AKR1C1 (20alpha-hydroxysteroid dehydrogenase) in the fission yeast Schizosaccharomyces pombe and demonstrate the ability of the resulting yeast strain to efficiently catalyze the reduction of progesterone or dydrogesterone. PMID: 20727920
  17. non-stereo-selective cytosolic human brain tissue 3-ketosteroid reductase is refractory to inhibition by AKR1C inhibitors PMID: 20673851
  18. Expression of dihydrodiol dehydrogenase in the resected stage I non-small cell lung cancer PMID: 11956619
  19. Reduction of dihydrodiol dehydrogenase expression is associated with resected hepatocellular carcinoma PMID: 12579257
  20. progesterone itself contributes to the regulation of local progesterone concentration through 20alpha-HSD levels in endometrial stromal cells at peri-implantation periods. PMID: 12733716
  21. X ray diffraction and site-directed mutagenesis: identification of an alternative binding site for C21-steroids PMID: 12899831
  22. Glaucomatous optic nerve head astrocytes express a higher level of 3 alpha-HSD isoform AKR1C1 and its mRNA than normal astrocytes. PMID: 13678667
  23. Expression of SRD5A1 (5alphaR1) and SRD5A2 (5alphaR2) is elevated, and expression of AKR1C1 (20alpha-HSO), AKR1C2 (3alpha-HSO3) and AKR1C3 (3alpha-HSO2) is reduced in tumorous as compared to normal breast tissue. PMID: 15212687
  24. Loss of AKR1C1 and AKR1C2 in breast cancer results in decreased progesterone catabolism, which, in combination with increased PR expression, may augment progesterone signaling by its nuclear receptors. PMID: 15492289
  25. mRNA abundance and activity of AKR1C enzymes in abdominal adipose tissue are positive correlates of adiposity in women. Increased progesterone and/or dihydrotestosterone reduction in abdominal adipose tissue may impact fat cell metabolism. PMID: 15494612
  26. The expression of AKR1C1 and AKR1C3 in endometrial cancer will govern the ratio of P:E2. PMID: 16338060
  27. DDH may play important roles in tumor progression of squamous cell carcinoma via induction of apoptosis- and drug-resistance PMID: 16361083
  28. Activity of AKR1C1 in overall oracin reduction was one order of magnitude higher compared to AKR1C2 and 1C4. PMID: 17618725
  29. Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), aldoketoreductase (AKR1C1) and prostaglandin F synthase (AKR1C3) were all expressed in hair follicles. PMID: 17697149
  30. Carbonyl reductase-1 (CBR1), microsomal prostaglandin E synthase-1 and 2 (mPGES-1, mPGES-2), cytosolic prostaglandin E synthase (cPGES), the aldoketoreductase AKR1C1 and the prostaglandin F synthase AKR1C3 were all expressed in hair follicles. PMID: 17697149
  31. Overexpression of AKR1C1 counteracted the S-phase accumulation of cells and apoptosis caused by MTX treatment. This suggests a role of AKR1C1 in cell proliferation. PMID: 17945194
  32. Incubations of normal human bronchial epithelial cells with individual heavy metals showed that the upregulation of AKR1C1 and AKR1C2 was predominantly caused by lead. PMID: 18654764
  33. Induction of preadipocyte differentiation increased expression levels of AKR1C1 and modified the pattern of progesterone metabolism substantially, leaving 20alpha-hydroxyprogesterone as the main metabolite generated. PMID: 18984031
  34. human AKR1C enzymes (AKR1C1-4) are able to reduce conjugated steroids such as Dht-17beta-glucuronide (DhtG), Dht-17beta-sulfate (DhtS), and Tib-17beta-sulfate (TibS) PMID: 19218247
  35. AKR1C subfamily genes are stress-inducible and might function as survival factors in keratinocytes. PMID: 19320734
  36. AKR1C isoforms as a novel target of jasmonates in cancer cells. PMID: 19487289
  37. Human AKR1C enzymatic activity plays crucial roles on induction of neoplastic transformation of mouse NIH3T3 cells. PMID: 19696165

Show More

Hide All

Subcellular Location
Cytoplasm, cytosol.
Protein Families
Aldo/keto reductase family
Tissue Specificity
Expressed in all tissues tested including liver, prostate, testis, adrenal gland, brain, uterus, mammary gland and keratinocytes. Highest levels found in liver, mammary gland and brain.
Database Links

HGNC: 384

OMIM: 600449

KEGG: hsa:1645

STRING: 9606.ENSP00000370254

UniGene: Hs.460260

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1