Recombinant Human Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 (ALKBH3)

Code CSB-EP847209HU
Abbreviation Recombinant Human ALKBH3 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
ALKBH3
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
1700108H04Rik ; 1810020C19Rik; ABH3; AlkB homolog 3; alkB; alkylation repair homolog 3 (E. coli); ALKB3_HUMAN; ALKBH3; Alkylated DNA repair protein alkB homolog 3; alkylation repair homolog 3; Alpha-ketoglutarate-dependent dioxygenase alkB homolog 3; DEPC 1; DEPC-1; DEPC1; EC 1.14.11.; FLJ43614; mABH3; MGC118790; MGC118792; MGC118793; MGC134125 ; PCA1; Prostate cancer antigen 1; Prostate cancer antigen-1; RP23-375N21.4
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-170aa
Target Protein Sequence
MEEKRRRARVQGAWAAPVKSQAIAQPATTAKSHLHQKPGQTWKNKEHHLSDREFVFKEPQQVVRRAPEPRVIEEGVYEISLSPTGVSRVCLYPGFVDVKEADWILEQLCQDVPWKQRTGIREDSILQLTFKKSAPVSGTATAPQSCWYERPSPPHIPGPAILTRTRLWAP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.3kDa
Protein Length
Full Length of Isoform 2
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Dioxygenase that mediates demethylation of DNA and RNA containing 1-methyladenosine (m1A). Repairs alkylated DNA containing 1-methyladenosine (m1A) and 3-methylcytosine (m3C) by oxidative demethylation. Has a strong preference for single-stranded DNA. Able to process alkylated m3C within double-stranded regions via its interaction with ASCC3, which promotes DNA unwinding to generate single-stranded substrate needed for ALKBH3. Also acts on RNA. Demethylates N(1)-methyladenosine (m1A) RNA, an epigenetic internal modification of messenger RNAs (mRNAs) highly enriched within 5'-untranslated regions (UTRs) and in the vicinity of start codons. Requires molecular oxygen, alpha-ketoglutarate and iron.
Gene References into Functions
  1. These data highlight a novel role for ALKBH3 in tumor progression via RNA demethylation and subsequent protein synthesis promotion. PMID: 28205560
  2. ALKBH3 is a novel addition to the catalogue of DNA repair genes found inactivated in breast cancer. Our results underscore a link between defective alkylation repair and breast cancer which, additionally, is found in association with poor disease outcome. PMID: 28679371
  3. The TP53 knockout shifted the phenotypes of A549 cells induced by ALKBH3 knockdown from cell cycle arrest to apoptosis induction, suggesting that the TP53 gene status is a critical determinant of the phenotypes induced by ALKBH3 knockdown in NSCLC cells. PMID: 28479246
  4. These results revealed that N3-ethylthymidine , but not other DNA lesions, could be repaired by Alkbh2 and Alkbh3 in mammalian cells. PMID: 26930515
  5. Results show that PCA1 expression was positively correlated with advanced stages in renal cell carcinoma and strongly suggest that PCA-1 may be functionally important and a novel molecular target for human renal cell carcinoma. PMID: 26035443
  6. It was shown for first time that DNA glycosylase ALKBH3 can repair DNA adduct 3,N4-ethenocytosine from single-stranded DNA. PMID: 25797601
  7. ALKBH3 contributes to development of urothelial carcinomas by accelerating their survival, angiogenesis, and invasion PMID: 22850567
  8. ALKBH3 gene silencing markedly induces apoptosis in hormone-independent prostate cancer cell line DU145. PMID: 22515525
  9. Our results establish PCA-1/ALKBH3 as important gene in pancreatic cancer PMID: 22826605
  10. DNA unwinding by ASCC3 helicase is coupled to ALKBH3-dependent DNA alkylation repair and cancer cell proliferation. PMID: 22055184
  11. ALKBH3 contributes significantly to cancer cell survival and may be a therapeutic target for human adenocarcinoma of the lung. PMID: 21285982
  12. This work has provided a detailed understanding of the structural features of the single-stranded DNA and double-stranded DNA preferences of ABH2 and ABH3. PMID: 20714506
  13. Divergent sequences outside of the active site determine substrate specificities of ABH3. PMID: 20525795
  14. Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator) PMID: 20970119
  15. Crystallographic study reveals beta-strand jelly-roll fold of hABH3 that coordinates a catalytically active iron center by a conserved His1-X-Asp/Glu-X(n)-His2 motif [ABH3] PMID: 16858410
  16. PCA-1 might be a novel diagnostic marker for prostate cancer, and increased PCA-1 expression might denote more aggressive variants of prostate cancer [PCA-1]. PMID: 17968469

Show More

Hide All

Subcellular Location
Nucleus. Cytoplasm.
Protein Families
AlkB family
Tissue Specificity
Ubiquitous. Detected in heart, pancreas, skeletal muscle, thymus, testis, ovary, spleen, prostate, small intestine, peripheral blood leukocytes, urinary bladder and colon.
Database Links

HGNC: 30141

OMIM: 610603

KEGG: hsa:221120

STRING: 9606.ENSP00000302232

UniGene: Hs.720708

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*