Recombinant Human Amelogenin, X isoform (AMELX)

In Stock
Code CSB-EP860753HU
Abbreviation Recombinant Human AMELX protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
AMELX
Uniprot No.
Research Area
Signal Transduction
Alternative Names
AI1E; AIH1; ALGN; Amel; Amelogenesis imperfecta 1; Amelogenin (amelogenesis imperfecta 1; X linked); Amelogenin (X chromosome); Amelogenin (X chromosome; amelogenesis imperfecta 1); Amelogenin; Amelogenin X isoform; Amelogenin; X linked; AMELX; AMELX_HUMAN; Amg; AMGL; AMGX; OTTHUMP00000022906; OTTHUMP00000022907; X isoform
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
17-191aa
Target Protein Sequence
MPLPPHPGHPGYINFSYEVLTPLKWYQSIRPPYPSYGYEPMGGWLHHQIIPVLSQQHPPTHTLQPHHHIPVVPAQQPVIPQQPMMPVPGQHSMTPIQHHQPNLPPPAQQPYQPQPVQPQPHQPMQPQPPVHPMQPLPPQPPLPPMFPMQPLPPMLPDLTLEAWPSTDKTKREEVD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
35.9kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays a role in biomineralization. Seems to regulate the formation of crystallites during the secretory stage of tooth enamel development. Thought to play a major role in the structural organization and mineralization of developing enamel.
Gene References into Functions
  1. High AMEL expression is associated with Aggressiveness in Odontogenic Tumors. PMID: 29802703
  2. To the best of our knowledge, this is the first report of expression of human amelogenin in plants, offering the possibility to use this plant-made protein for nanotechnological applications. PMID: 28801830
  3. a single-nucleotide polymorphism in the amelogenin gene using amplified product-length polymorphisms in combination with sex-determining region Y analysis, is reported. PMID: 28052096
  4. Full-length amelogenin may have a negative mitogenic impact on human dental pulp stem cells. PMID: 26762641
  5. suggestive overrepresentation of TT genotype of amelogenin marker in cases w/severe erosion when compared to no dentine erosion. Amelogenin also associated with severe erosion in recessive model; TT genotype significantly more frequent in affected group PMID: 25791822
  6. Studies indicate that a single point mutation (41Pro-->Thr) in the amelogenin gene causes severe dental enamel malformation known as amelogenesis imperfect. PMID: 26545753
  7. sequencing data showed presence of mutation. Samples showing mutation (43.3%) showed high correlation with caries (80.7%) experience which was statistically significant. PMID: 26551370
  8. silent mutation in exon 4 of AMELX gene. generating and characterizing transgenic animal model, alteration of the ratio and quantity of the developmentally conserved alternative splicing repertoire of AMELX caused defects in enamel matrix mineralization. PMID: 25117480
  9. Conversion to amelogenin expressing dental epithelial cells involved an up-regulation of the stem cell marker Sox2 and proliferation genes and decreased expression of mesenchymal markers PMID: 25122764
  10. the interaction of amelogenin with Grp78/Bip contributed to cell proliferation, rather than correlate with the osteogenic differentiation PMID: 24167599
  11. demonstrate the presence of copy number variations in regions containing 9 of the 13 CODIS(Combined DNA Index System) short tandem repeat(STR) and AMELX/Y loci PMID: 23948316
  12. Associations between TFIP11 (p=0.02), ENAM (p=0.00001), and AMELX (p=0.01) could be seen with caries independent of having MIH or genomic DNA copies of Streptococcus mutans detected by real time PCR in the Brazilian sample. PMID: 23790503
  13. The 21 non-CODIS STR loci of the Russian ethnic minority group were characterized by high genetic diversity and therefore may be useful for elucidating the population's genetic background, for individual identification. PMID: 23733431
  14. Deletion of AMELX results in males with a characteristic snow-capped enamel phenotype. PMID: 23251683
  15. Evolutionary and statistical analyses showed that none of the SNPs identified in this study were associated with caries susceptibility, suggesting that AMELX is not a gene candidate in our studied population. PMID: 23525533
  16. These results suggest that SNPs of AMELX might be associated with dental caries susceptibility in Korean population. PMID: 21114591
  17. A single Pro-70 to Thr (p.P70T) mutation of amelogenin affected the self-assembly and adsorption behaviour of amelogenin, resulting in increased binding to apatite and inhibited crystal growth. PMID: 21081224
  18. These results suggest that hAm may be a key element in regulating hBMSCs osteogenic differentiation. PMID: 21514271
  19. Perturbed amelogenin secondary structure leads to uncontrolled aggregation in amelogenesis imperfecta mutant proteins. PMID: 20929860
  20. amelogenin may stimulate wound healing by providing connective tissue cells with a temporary extracellular matrix PMID: 20012165
  21. frameshift mutation encoding a truncated amelogenin leads to X-linked amelogenesis imperfecta PMID: 11839357
  22. self-assembly and apatite binding properties of amelogenin proteins lacking the hydrophilic C-terminal. PMID: 11852235
  23. Altered amelogenin self-assembly based on mutations observed in human X-linked amelogenesis imperfecta (AIH1). PMID: 11877393
  24. C-terminus of the normal amelogenin protein is important for controlling enamel thickness. PMID: 11922869
  25. 2 mutations within coding region for amelogenin signal peptide predicted to interfere with secretion of amelogenin; could help clinicians in making diagnosis of X-linked AI. PMID: 15111628
  26. Two synonymous single-nucleotide polymorphisms were found in databases. Alignment of the primate exon 6 sequences revealed that AMELX is highly constrained. PMID: 17645864
  27. Amelogenin locus in chimerism monitoring of stem cell patients transplanted. PMID: 17688372
  28. Having at least one copy of the rare amelogenin marker allele was associated with increased age-adjusted caries experience. PMID: 18042988
  29. Binding of the P41T mutant amelogenin for matrix metalloproteinase 20 was significantly lower than that of wild-type amelogenin. PMID: 18434575
  30. Prolines at the amelogenin C terminus are essential for the initial processing of amelogenin and amelogenin-mineral interactions. PMID: 18701806
  31. A total of 463 individuals from 54 families were evaluated and mutations in the AMEL, ENAM and KLK4 genes were identified. PMID: 18714142
  32. Overrepresentation of C allele of amelogenin marker was seen in dmft scores higher than 8 when compared to controls. Overrepresentation of T allele of ameloblastin marker was seen in dmfs scores higher than 10 when compared to controls. PMID: 18781068
  33. Amelogenin can adsorb onto surfaces as small structures that "shed" or disassemble from the nanospheres that are present in solution. PMID: 19025992
  34. Forensic genetic genotyping system using amelogenin using single nucleotide polymorphism. PMID: 19083859
  35. In a family with a hypomaturation-type enamel defect, mutational and haplotype analyses revealed no mutations in the AMELX gene. PMID: 19966041

Show More

Hide All

Involvement in disease
Amelogenesis imperfecta 1E (AI1E)
Subcellular Location
Secreted, extracellular space, extracellular matrix.
Protein Families
Amelogenin family
Database Links

HGNC: 461

OMIM: 300391

KEGG: hsa:265

UniGene: Hs.654436

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*