Recombinant Human Anamorsin (CIAPIN1)

In Stock
Code CSB-EP738750HU
Abbreviation Recombinant Human CIAPIN1 protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
CIAPIN1
Uniprot No.
Research Area
Apoptosis
Alternative Names
2810413N20Rik; Anamorsin; CIAPIN 1; CIAPIN1; CPIN1_HUMAN; Cytokine induced apoptosis inhibitor 1; Cytokine-induced apoptosis inhibitor 1; DRE2; Fe-S cluster assembly protein DRE2 homolog; Predicted protein of HQ0915; PRO0915
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-312aa
Target Protein Sequence
MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
49.6kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Constructing a plasmid encoding the Human CIAPIN1 protein (1-312aa) initiates the general approach for generating the recombinant Human CIAPIN1 protein. Transformation of the plasmid into e.coli cells obtains the plasmid-containing e.coli cells, which are cultured and induced for protein expression. A N-terminal 6xHis-SUMO tag is fused to the protein. Subsequently, the protein is purified through affinity purification, and SDS-PAGE analysis is undertaken to confirm the presence and assess the purity of the protein. The protein's purity exceeds 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex NUBP1-NUBP2. Electrons are transferred to CIAPIN1 from NADPH via the FAD- and FMN-containing protein NDOR1. NDOR1-CIAPIN1 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit. Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells.
Gene References into Functions
  1. the effects of CIAPIN-1 in chondrocytes, focusing on extracellular signal-regulated kinase (ERK)-1/2 and p38 kinase signaling PMID: 27644154
  2. results of the present study suggest that downregulation of the CIAPIN1 gene in multiple myeloma cells may be associated with the development of this disease. PMID: 25901506
  3. CIAPIN1 and ABCA13 may be novel markers of poor outcome in pre-chemotherapy serous carcinoma effusions. PMID: 25889687
  4. CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation. PMID: 25724898
  5. lentivirus-vector-mediated RNAi targeting of CIAPIN1 is a potential approach to reverse MDR of breast cancer and CIAPIN1 may participate in MDR of breast cancer by regulating P-glycoprotein and P53 expression. PMID: 24676475
  6. the 25-kDa cleaved fragment of anamorsin was detected in post-mortem brains of Alzheimer and Parkinson disease patients PMID: 24973211
  7. The N-terminal methyltransferase-like domain of anamorsin probably functions as a structural scaffold to inhibit methyl transfers. PMID: 24123282
  8. CIAPIN1 targeted NHE1 to mediate differentiation of K562 cells via ERK1/2 pathway. PMID: 25043809
  9. Mossbauer and EPR spectra of human anamorsin show that both the M1 motif and the M2 motif bind independently a [2Fe-2S] cluster through the four cysteines of each motif. PMID: 23989406
  10. CIAPIN1 siRNA inhibited proliferation, migration and promotes apoptosis of vascular smooth muscle cells by regulating Bcl-2 and Bax. PMID: 23151078
  11. the molecular basis of recognition between Ndor1 and anamorsin and of the electron transfer process, was investigated. PMID: 23596212
  12. Elevated expression of nuclear CIAPIN1 negatively correlated with the survival of epithelial ovarian cancer patients PMID: 22713669
  13. In summary, our work revealed a novel function of CIAPIN1, which might possibly be used as an independent prognostic factor and a potential therapeutic target for pancreatic cancer PMID: 22677939
  14. Up-regulation of CIAPIN1 expression may play an important role in pathogenesis of leukemia. PMID: 21729524
  15. Anamorsin is a Mia40-dependent but ALR-independent IMS-protein and binds a [2Fe-2S] cluster before and after specific Mia40-driven Cys-oxidation. PMID: 21700214
  16. Results of immunohistochemical study showed that CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a prognostic indicator in esophageal squamous cell carcinoma. PMID: 20411424
  17. Low expression of CIAPIN1 is associated with colorectal cancer. PMID: 20815902
  18. it is concluded that CIAPIN1 confers multidrug resistance in gastric cancer cells, likely by upregulating MDR-1 and MRP-1 PMID: 16410721
  19. CIAPIN1 was localized in both the cytoplasm and the nucleus and was accumulated in the nucleolus. Bioinformatic prediction disclosed a putative nuclear localization signal and a putative nuclear export signal within human CIAPIN1. PMID: 16957168
  20. CIAPIN1 might be a DNA or RNA methyltransferase. PMID: 17935775
  21. These findings suggest that downregulating CIAPIN1 could sensitize leukemia cells to chemotherapeutic drugs by downregulating MDR-1 and Bcl-2 and by upregulating Bax. PMID: 18059532
  22. anamorsin expression in DLBCL patients with a low IPI was shown to be an unfavorable biomarker; anamorsin might play some roles in the abnormal growth of DLBCL. PMID: 18203020
  23. CIAPIN1 is a suppressor of gastric cancer cell proliferation; CIAPIN1 might play an important role in the development of human gastric cancer. PMID: 18293492
  24. Knock down of CIAPIN1 by adenovirus-delivered siRNA may be a potential therapeutic strategy for treatment of hepatocellular carcinoma in which CIAPIN1 is overexpressed. PMID: 18299278
  25. correlation between CIAPIN1 down regulation and decreased MDR1 transcriptional activity were observed. PMID: 18389626
  26. the CIAPIN1 genet could be used as a clinical marker to identify patients with CCRCC. PMID: 19081179

Show More

Hide All

Subcellular Location
Cytoplasm. Nucleus. Mitochondrion intermembrane space.
Protein Families
Anamorsin family
Tissue Specificity
Ubiquitously expressed. Highly expressed in heart, liver and pancreas.
Database Links

HGNC: 28050

OMIM: 608943

KEGG: hsa:57019

STRING: 9606.ENSP00000377914

UniGene: Hs.4900

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*