Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

CIAPIN1

Uniprot No.

Q6FI81

Research Area

Apoptosis

Alternative Names

2810413N20Rik; Anamorsin; CIAPIN 1; CIAPIN1; CPIN1_HUMAN; Cytokine induced apoptosis inhibitor 1; Cytokine-induced apoptosis inhibitor 1; DRE2; Fe-S cluster assembly protein DRE2 homolog; Predicted protein of HQ0915; PRO0915

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

1-312aa

Target Protein Sequence

MADFGISAGQFVAVVWDKSSPVEALKGLVDKLQALTGNEGRVSVENIKQLLQSAHKESSFDIILSGLVPGSTTLHSAEILAEIARILRPGGCLFLKEPVETAVDNNSKVKTASKLCSALTLSGLVEVKELQREPLTPEEVQSVREHLGHESDNLLFVQITGKKPNFEVGSSRQLKLSITKKSSPSVKPAVDPAAAKLWTLSANDMEDDSMDLIDSDELLDPEDLKKPDPASLRAASCGEGKKRKACKNCTCGLAEELEKEKSREQMSSQPKSACGNCYLGDAFRCASCPYLGMPAFKPGEKVLLSDSNLHDA
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

49.6kDa

Protein Length

Full Length

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Constructing a plasmid encoding the Human CIAPIN1 protein (1-312aa) initiates the general approach for generating the recombinant Human CIAPIN1 protein. Transformation of the plasmid into e.coli cells obtains the plasmid-containing e.coli cells, which are cultured and induced for protein expression. A N-terminal 6xHis-SUMO tag is fused to the protein. Subsequently, the protein is purified through affinity purification, and SDS-PAGE analysis is undertaken to confirm the presence and assess the purity of the protein. The protein's purity exceeds 90%.

Target Background

Function

Component of the cytosolic iron-sulfur (Fe-S) protein assembly (CIA) machinery required for the maturation of extramitochondrial Fe-S proteins. Part of an electron transfer chain functioning in an early step of cytosolic Fe-S biogenesis, facilitating the de novo assembly of a [4Fe-4S] cluster on the scaffold complex NUBP1-NUBP2. Electrons are transferred to CIAPIN1 from NADPH via the FAD- and FMN-containing protein NDOR1. NDOR1-CIAPIN1 are also required for the assembly of the diferric tyrosyl radical cofactor of ribonucleotide reductase (RNR), probably by providing electrons for reduction during radical cofactor maturation in the catalytic small subunit. Has anti-apoptotic effects in the cell. Involved in negative control of cell death upon cytokine withdrawal. Promotes development of hematopoietic cells.

Gene References into Functions

the effects of CIAPIN-1 in chondrocytes, focusing on extracellular signal-regulated kinase (ERK)-1/2 and p38 kinase signaling PMID: 27644154
results of the present study suggest that downregulation of the CIAPIN1 gene in multiple myeloma cells may be associated with the development of this disease. PMID: 25901506
CIAPIN1 and ABCA13 may be novel markers of poor outcome in pre-chemotherapy serous carcinoma effusions. PMID: 25889687
CIAPIN1 over-expression decreases NHE1 expression and ERK1/2 phosphorylation. PMID: 25724898
lentivirus-vector-mediated RNAi targeting of CIAPIN1 is a potential approach to reverse MDR of breast cancer and CIAPIN1 may participate in MDR of breast cancer by regulating P-glycoprotein and P53 expression. PMID: 24676475
the 25-kDa cleaved fragment of anamorsin was detected in post-mortem brains of Alzheimer and Parkinson disease patients PMID: 24973211
The N-terminal methyltransferase-like domain of anamorsin probably functions as a structural scaffold to inhibit methyl transfers. PMID: 24123282
CIAPIN1 targeted NHE1 to mediate differentiation of K562 cells via ERK1/2 pathway. PMID: 25043809
Mossbauer and EPR spectra of human anamorsin show that both the M1 motif and the M2 motif bind independently a [2Fe-2S] cluster through the four cysteines of each motif. PMID: 23989406
CIAPIN1 siRNA inhibited proliferation, migration and promotes apoptosis of vascular smooth muscle cells by regulating Bcl-2 and Bax. PMID: 23151078
the molecular basis of recognition between Ndor1 and anamorsin and of the electron transfer process, was investigated. PMID: 23596212
Elevated expression of nuclear CIAPIN1 negatively correlated with the survival of epithelial ovarian cancer patients PMID: 22713669
In summary, our work revealed a novel function of CIAPIN1, which might possibly be used as an independent prognostic factor and a potential therapeutic target for pancreatic cancer PMID: 22677939
Up-regulation of CIAPIN1 expression may play an important role in pathogenesis of leukemia. PMID: 21729524
Anamorsin is a Mia40-dependent but ALR-independent IMS-protein and binds a [2Fe-2S] cluster before and after specific Mia40-driven Cys-oxidation. PMID: 21700214
Results of immunohistochemical study showed that CIAPIN1 might play an important role in esophageal carcinogenesis, and it could be considered as a prognostic indicator in esophageal squamous cell carcinoma. PMID: 20411424
Low expression of CIAPIN1 is associated with colorectal cancer. PMID: 20815902
it is concluded that CIAPIN1 confers multidrug resistance in gastric cancer cells, likely by upregulating MDR-1 and MRP-1 PMID: 16410721
CIAPIN1 was localized in both the cytoplasm and the nucleus and was accumulated in the nucleolus. Bioinformatic prediction disclosed a putative nuclear localization signal and a putative nuclear export signal within human CIAPIN1. PMID: 16957168
CIAPIN1 might be a DNA or RNA methyltransferase. PMID: 17935775
These findings suggest that downregulating CIAPIN1 could sensitize leukemia cells to chemotherapeutic drugs by downregulating MDR-1 and Bcl-2 and by upregulating Bax. PMID: 18059532
anamorsin expression in DLBCL patients with a low IPI was shown to be an unfavorable biomarker; anamorsin might play some roles in the abnormal growth of DLBCL. PMID: 18203020
CIAPIN1 is a suppressor of gastric cancer cell proliferation; CIAPIN1 might play an important role in the development of human gastric cancer. PMID: 18293492
Knock down of CIAPIN1 by adenovirus-delivered siRNA may be a potential therapeutic strategy for treatment of hepatocellular carcinoma in which CIAPIN1 is overexpressed. PMID: 18299278
correlation between CIAPIN1 down regulation and decreased MDR1 transcriptional activity were observed. PMID: 18389626
the CIAPIN1 genet could be used as a clinical marker to identify patients with CCRCC. PMID: 19081179

Hide All

Subcellular Location

Cytoplasm. Nucleus. Mitochondrion intermembrane space.

Protein Families

Anamorsin family

Tissue Specificity

Ubiquitously expressed. Highly expressed in heart, liver and pancreas.

Database Links

HGNC: 28050

OMIM: 608943

KEGG: hsa:57019

STRING: 9606.ENSP00000377914

UniGene: Hs.4900

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
If CAPTCHA verification fails, click to refresh the CAPTCHA and try again.

Code	CSB-EP738750HU
Abbreviation	Recombinant Human CIAPIN1 protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Anamorsin (CIAPIN1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage