Purity
Greater than 85% as determined by SDS-PAGE.
Research Area
Cardiovascular
Alternative Names
35 beta calcimedin; 35-beta calcimedin; AIV; Annexin 4; Annexin A4; Annexin IV (placental anticoagulant protein II); Annexin IV; Annexin IV placental anticoagulant protein II; Annexin-4; AnnexinA4; AnnexinIV; ANX 4; ANX A4; ANX4; ANXA 4; ANXA4; ANXA4 protein; ANXA4_HUMAN; Carbohydrate binding protein P33/P41; Carbohydrate-binding protein p33/p41; Chromobindin 4; Chromobindin-4; Chromobindin4; DKFZp686H02120; Endonexin I; EndonexinI; Lipocortin IV; LipocortinIV; MGC75105; OTTHUMP00000160052; OTTHUMP00000202207; P32.5; P33/41; PAP II; PAP-II; PAPII; PIG 28; PIG28; Placental anticoagulant protein II; PP4 X; PP4-X; PP4X; Proliferation inducing gene 28; Proliferation inducing protein 28; Protein II; Xanx-4; ZAP 36; ZAP36
Species
Homo sapiens (Human)
Expression Region
2-319aa
Target Protein Sequence
ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Amino acids 2-319 constitute the expression domain of recombinant Human ANXA4. This ANXA4 protein is theoretically predicted to have a molecular weight of 55.8 kDa. This ANXA4 recombinant protein is manufactured in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of ANXA4, making it easier to detect and purify the ANXA4 recombinant protein in the later stages of expression and purification.
Annexin A4 (ANXA4) is a protein that has recently attracted a lot of attention in research, especially in the study of cancer. It plays a crucial role in tumor invasion and metastasis. Researchers have found that when ANXA4 is excessively expressed, it is closely linked to the development and worsening of certain cancers, such as breast cancer and lung cancer. This makes ANXA4 a potential marker for cancer and a target for treatment, offering new perspectives for detecting and treating cancer early. Additionally, ANXA4 is connected to the regulation of inflammation and the immune system. Studies show its involvement in controlling cell apoptosis, inflammatory responses, and immune regulation, providing important insights into understanding diseases related to the immune system and inflammation.
