Recombinant Human Annexin A4 (ANXA4)

In Stock
Code CSB-EP001845HU
Abbreviation Recombinant Human ANXA4 protein
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Target Names
ANXA4
Uniprot No.
Research Area
Cardiovascular
Alternative Names
35 beta calcimedin; 35-beta calcimedin; AIV; Annexin 4; Annexin A4; Annexin IV (placental anticoagulant protein II); Annexin IV; Annexin IV placental anticoagulant protein II; Annexin-4; AnnexinA4; AnnexinIV; ANX 4; ANX A4; ANX4; ANXA 4; ANXA4; ANXA4 protein; ANXA4_HUMAN; Carbohydrate binding protein P33/P41; Carbohydrate-binding protein p33/p41; Chromobindin 4; Chromobindin-4; Chromobindin4; DKFZp686H02120; Endonexin I; EndonexinI; Lipocortin IV; LipocortinIV; MGC75105; OTTHUMP00000160052; OTTHUMP00000202207; P32.5; P33/41; PAP II; PAP-II; PAPII; PIG 28; PIG28; Placental anticoagulant protein II; PP4 X; PP4-X; PP4X; Proliferation inducing gene 28; Proliferation inducing protein 28; Protein II; Xanx-4; ZAP 36; ZAP36
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-319aa
Target Protein Sequence
ATKGGTVKAASGFNAMEDAQTLRKAMKGLGTDEDAIISVLAYRNTAQRQEIRTAYKSTIGRDLIDDLKSELSGNFEQVIVGMMTPTVLYDVQELRRAMKGAGTDEGCLIEILASRTPEEIRRISQTYQQQYGRSLEDDIRSDTSFMFQRVLVSLSAGGRDEGNYLDDALVRQDAQDLYEAGEKKWGTDEVKFLTVLCSRNRNHLLHVFDEYKRISQKDIEQSIKSETSGSFEDALLAIVKCMRNKSAYFAEKLYKSMKGLGTDDNTLIRVMVSRAEIDMLDIRAHFKRLYGKSLYSFIKGDTSGDYRKVLLVLCGGDD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
55.8 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Amino acids 2-319 constitute the expression domain of recombinant Human ANXA4. This ANXA4 protein is theoretically predicted to have a molecular weight of 55.8 kDa. This ANXA4 recombinant protein is manufactured in e.coli. The N-terminal 10xHis-SUMO tag and C-terminal Myc tag was fused into the coding gene segment of ANXA4, making it easier to detect and purify the ANXA4 recombinant protein in the later stages of expression and purification.

Annexin A4 (ANXA4) is a protein that has recently attracted a lot of attention in research, especially in the study of cancer. It plays a crucial role in tumor invasion and metastasis. Researchers have found that when ANXA4 is excessively expressed, it is closely linked to the development and worsening of certain cancers, such as breast cancer and lung cancer. This makes ANXA4 a potential marker for cancer and a target for treatment, offering new perspectives for detecting and treating cancer early. Additionally, ANXA4 is connected to the regulation of inflammation and the immune system. Studies show its involvement in controlling cell apoptosis, inflammatory responses, and immune regulation, providing important insights into understanding diseases related to the immune system and inflammation.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.
Gene References into Functions
  1. ANXA4 expression was increased at both the mRNA and protein level in the drugresistant ovarian cancer cells, and ANXA4 contained a Lewis(y) structure. ANXA4 overexpression can abnormally activate signaling pathways and regulate the expression of a numbers of factors, forming a positive feedback loop to induce the chemoresistance of ovarian cancer cells. PMID: 30066907
  2. Annexin A4 binds to artificial membranes and generates curvature force initiated from free edges, whereas annexin A6 induces constriction force. PMID: 29158488
  3. Taken together, these data indicate that up-regulation of ANXA4 leads to activation of the NF-kappaB pathway and its target genes in a feedback regulatory mechanism via the p65 subunit, resulting in tumor growth in GBC. PMID: 27491820
  4. Upregulation and nuclear translocation of ANXA4 have been observed in the progression of colorectal cancer and ovarian serous carcinoma. Knockdown of ANXA4 attenuated migration in ovarian cancer and breast cancer cells. In contrast, knockdown of ANXA4 increased susceptibility to platinum in ovarian cancer and malignant mesothelioma cells. Review. PMID: 27100483
  5. Study identifies ANXA4 and FLNA as up-regulated in buccal squamous cell carcinoma arising from oral submucous fibrosis. PMID: 27485544
  6. High ANXA4 expression is associated with metastasis of hepatocellular carcinoma. PMID: 26779633
  7. annexin A4 can be regarded as an important molecular marker in triple-negative breast cancer prognosis. PMID: 27650619
  8. role of annexin A4 in cancer PMID: 26048190
  9. Data shows that CYTB and ANXA4 overexpression may be involved in carcinogenesis and histopathological differentiation of ovarian clear cell carcinoma and suggest they may serve as a potential diagnostic biomarkers. PMID: 25633807
  10. These findings indicate that the calcium-binding site in the ANXA4 repeat induces chemoresistance to the platinum-based drug by elevating the intracellular chloride concentration. PMID: 25277200
  11. Fhit delocalizes annexin A4 from plasma membrane to cytosol and sensitizes lung cancer cells to paclitaxel. PMID: 24223161
  12. enhanced expression of Anx A4 confers platinum resistance by promoting efflux of platinum drugs via ATP7A. PMID: 24150977
  13. This study showed that overexpression and nuclear localization of annexin A4 are related to chemoresistance and poor survival in patients with serous papillary ovarian carcinomas. PMID: 23290009
  14. suggest that ANXA4 triggers a signaling cascade, leading to increased epithelial cell proliferation, ultimately promoting carcinogenesis PMID: 22970268
  15. Lower expression of annexin A4 during window of implantation in infertile patients with endometriosis might be associated with the decrease of endometrial receptivity. PMID: 22883517
  16. Eight ANXA4 polymorphisms are significantly associated with the risk of aspirin-exacerbated respiratory disease. PMID: 22847161
  17. that H3K4 tri- and dimethylation play an important role and that JARID1A is the histone-demethylating enzyme responsible for removal of this mark PMID: 21348943
  18. In an Alzheimer model, transgenic mice overexpressing mutant human amyloid precursor protein (APP) show a significant increase of annexin A5 in the brain cortex but not in other organs, including liver, kidney, lung, and intestine. PMID: 20648654
  19. Annexin A4 differentially modulates the NF-kappaB signaling pathway, depending on its interactions with p50 and the intracellular Ca(2+) ion level. PMID: 20237821
  20. The overexpression of Annexin IV may be an ovarian CCC-specific molecular marker. PMID: 19955935
  21. annexin IV plays an important role in the morphological diversification and dissemination of the clear cell renal cell carcinoma PMID: 15145526
  22. This work provides mechanistic insight into how annexin A4 may regulate plasma membrane protein function. PMID: 16687573
  23. ANXA4 transcription and translation are regulated by progesterone. ANXA4 may be important in regulating ion and water transport across the endometrial epithelium. PMID: 16954445
  24. There were no significant differences in plasma annexin IV levels between women with and without antiphospholipid antibodies PMID: 17363042
  25. Enhanced expression of Annexin A4 is associated with clear cell carcinoma of the ovary PMID: 19598262

Show More

Hide All

Subcellular Location
Zymogen granule membrane; Peripheral membrane protein.
Protein Families
Annexin family
Database Links

HGNC: 542

OMIM: 106491

KEGG: hsa:307

STRING: 9606.ENSP00000377833

UniGene: Hs.422986

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*