Recombinant Human Annexin A6 (ANXA6), partial

Code CSB-RP007944h
Abbreviation Recombinant Human ANX6 protein, partial
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
67 kDa calelectrin; Annexin A6; Annexin VI; Annexin VI p68; Annexin-6; AnnexinA6; AnnexinVI; ANX 6; ANX A6; ANX6; ANXA 6; ANXA6; ANXA6_HUMAN; Calcium binding protein p68; Calelectrin; Calphobindin II; Calphobindin-II; CalphobindinII; CBP 68; CBP68; Chromobindin 20; Chromobindin-20; Chromobindin20; CPB II; CPB-II; CPBII; Lipocortin VI; LipocortinVI; p68; p70; Protein III; ProteinIII
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-245aa
Target Protein Sequence
AKPAQGAKYRGSIHDFPGFDPNQDAEALYTAMKGFGSDKEAILDIITSRSNRQRQEVCQSYKSLYGKDLIADLKYELTGKFERLIVGLMRPPAYCDAKEIKDAISGIGTDEKCLIEILASRTNEQMHQLVAAYKDAYERDLEADIIGDTSGHFQKMLVVLLQGTREEDDVVSEDLVQQDVQDLYEAGELKWGTDEAQFIYILGNRSKQHLRLVFDEYLKTTGKPIEASIRGELSGDFEKLMLAV
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
54.4kDa
Protein Length
Partial
Tag Info
N-terminal GST-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
May associate with CD21. May regulate the release of Ca(2+) from intracellular stores.
Gene References into Functions
  1. This review will discuss how the multiple scaffold functions may enable AnxA6 to modulate migratory cell behavior in health and disease PMID: 28060548
  2. Immunoprecipitation of the products obtained from the transcription/translation system using various anti-annexin A6 antibodies confirmed the presence of several isoforms and suggested that this protein might be present in different configurations. PMID: 27743858
  3. AnxA6 protein in adipocytes was upregulated by oxidative stress which might trigger AnxA6 induction in adipose tissues and contribute to impaired fat storage and adiponectin release. PMID: 27702590
  4. High ANXA6 expression is associated with neoplasms. PMID: 28881357
  5. stable or transient AnxA6 overexpression in HuH7 cells led to elevated lipid droplet numbers/size and neutral lipid staining under control conditions PMID: 28712927
  6. Annexin VI is enriched in calcifying valve interstitial cell derived-matrix vesicles from patients with end stage renal disease-induced hypercalcemia and aortic valve calcification. PMID: 28369848
  7. These findings suggest that cancer-associated fibroblasts -tumor cell crosstalk supported by ANXA6+ EVs is predictive of pancreatic ductal adenocarcinoma aggressiveness, highlighting a therapeutic target and potential biomarker for pancreatic ductal adenocarcinoma. PMID: 27701147
  8. The current study shows that AnxA6 is specifically reduced in human hepatocellular carcinoma suggesting a role of this protein in hepatocarcinogenesis. PMID: 27334756
  9. Data suggest that reduced ability of AnxA6-expressing cells to migrate is associated with decreased cell surface expression of integrins alphaVbeta3 and alpha5beta1. PMID: 26578516
  10. ANXA6 was detected as a novel systemic lupus erythematosus susceptibility gene, with several single-nucleotide polymorphisms (SNPs) contributing independently to the association with disease PMID: 26202167
  11. ANXA6 is a EZH2 target gene involving gastric cellular proliferation. PMID: 25947258
  12. Evidence for annexin A6-dependent plasma membrane remodelling of lipid domains PMID: 25409976
  13. The rapid degradation of activated EGFR in AnxA6-depleted invasive tumor cells underlies their sensitivity to EGFR-targeted inhibitors. PMID: 24354805
  14. These results show that influenza A virus replication depends on maintenance of the cellular cholesterol balance and identify AnxA6 as a critical factor in linking the virus to cellular cholesterol homeostasis. PMID: 24194536
  15. TNIP1/ANXA6 and CSMD1 variants interacting with cigarette smoking and alcohol intake affect risk of psoriasis. PMID: 23541940
  16. Influence of the 524-VAAEIL-529 sequence of annexins A6 in their interfacial behavior and interaction with lipid monolayers. PMID: 23683957
  17. Ca(2+) is the main factor which regulates the interaction of AnxA6 with monolayers composed of neutral lipids, determine AnxA6 localization in cholesterol and sphingomyelin enriched microdomains, thus contributing to the etiology of the NPC disease. PMID: 23360953
  18. AnxA6 is a new PKCalpha scaffold to promote PKCalpha-mediated EGFR inactivation. PMID: 22797061
  19. anxA6 inhibits Drp1 activity, and Ca(2+)-binding to anxA6 relieves this inhibition to permit Drp1-mediated mitochondrial fission PMID: 23341998
  20. AnxA6 via its stimulatory actions on PKCalpha and its role in mediating Ca(2+) flux across membranes regulates terminal differentiation and mineralization events of chondrocytes. PMID: 22399299
  21. the regulation of cell surface receptors by annexin A6 may be facilitated by its unique structure that allows recruitment of interaction partners and simultaneously bridging specialized membrane domains with cortical actin surrounding activated receptors PMID: 21990038
  22. AnxA6 is a novel receptor that mediates the endocytosis of bovine beta-glucuronidase. PMID: 21672540
  23. In addition to regulating cholesterol and caveolin distribution, AnxA6 acts as a scaffold/targeting protein for several signaling proteins. PMID: 20888375
  24. reduced AnxA6 expression contributes to breast cancer progression by promoting the loss of functional cell-cell and/or cell-ECM contacts and anchorage-independent cell proliferation PMID: 21185831
  25. In the presence of calcium, AnxA6 re-located to the fractions enriched in detergent-resistant microdomains only in the Niemann-Pick type C disease cells, suggestive of AnxA6 participation in organization of these microdomains. PMID: 21216236
  26. High ANXA6 expression in the cytoplasm is associated with uterine cervix carcinogenesis. PMID: 21119665
  27. Data suggests that the hydroxyl group of cholesterol and Trp 343 are involved in AnxA6-membrane interactions. PMID: 20363475
  28. AnxA6 may participate in formation of cholesterol-rich platforms on LE and therefore may contribute to the pathology of the NPC disease. PMID: 19900398
  29. Data show that annexin 6 is a candidate receptor for chondroitin sulfate chains. PMID: 12140262
  30. Characterization of phosphorylation-mimicking mutant annexin VI (T356D) reveals a potential regulatory mechanism leading to a higher degree of flexibility and possibly a higher calcium binding affinity of annexin VI upon phosphorylation. PMID: 12534274
  31. The nucleotide-binding site of ANXA6 is formed by the amino acid residues located in both halves of the protein, in two distinct domains. PMID: 12885247
  32. cell surface annexin VI may function as an acidic pH binding site or receptor and may also function as a co-receptor with LRP-1 at neutral pH PMID: 15226301
  33. endogenous annexin 6 could regulate the Maxi-chloride channel in placenta PMID: 15355961
  34. TPD52 bound to annexin VI in a Ca(2+)-dependent manner suggesting that these molecules may act in concert to regulate secretory processes in plasma cells PMID: 15576473
  35. Macrophage reprogramming during oxidative stress occurs through the cytosolic mobilization of annexin VI from lipid rafts. PMID: 16153422
  36. It is a first report supporting the hypothesis of a direct implication of AnxA6 in vitamin A-dependent tissue mineralization. PMID: 16674946
  37. Annexin A6 has roles in alterations in cholesterol transport and caveolin export from the Golgi complex PMID: 17822395
  38. AnxA6 interferes with caveolin transport through the inhibition of cPLA(2). PMID: 18245088
  39. annexin A6 contributes to the calcium-dependent cell surface exposition of the membrane associated-S100A8/A9 complex PMID: 18786929
  40. Annexin A6 is highly abundant in monocytes of obese and type 2 diabetic individuals. PMID: 19322030
  41. results implicate annexin A6 in the actin-dependent regulation of Ca(2+) entry, with consequences for the rates of cell proliferation PMID: 19386597

Show More

Hide All

Subcellular Location
Cytoplasm. Melanosome. Note=Identified by mass spectrometry in melanosome fractions from stage I to stage IV.
Protein Families
Annexin family
Database Links

HGNC: 544

OMIM: 114070

KEGG: hsa:309

STRING: 9606.ENSP00000346550

UniGene: Hs.412117

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*