Recombinant Human Antigen peptide transporter 2 (TAP2), partial

Code CSB-YP023121HU
MSDS
Size Pls inquire
Source Yeast
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023121HU
MSDS
Size Pls inquire
Source E.coli
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-EP023121HU-B
MSDS
Size Pls inquire
Source E.coli
Conjugate Avi-tag Biotinylated
E. coli biotin ligase (BirA) is highly specific in covalently attaching biotin to the 15 amino acid AviTag peptide. This recombinant protein was biotinylated in vivo by AviTag-BirA technology, which method is BriA catalyzes amide linkage between the biotin and the specific lysine of the AviTag.
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-BP023121HU
MSDS
Size Pls inquire
Source Baculovirus
Have Questions? Leave a Message or Start an on-line Chat
Code CSB-MP023121HU
MSDS
Size Pls inquire
Source Mammalian cell
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
>85% (SDS-PAGE)
Target Names
Uniprot No.
Alternative Names
Antigen peptide transporter 2; APT2; EC 7.4.2.14; ATP-binding cassette sub-family B member 3; Peptide supply factor 2; Peptide transporter PSF2; PSF-2; Peptide transporter TAP2; Peptide transporter involved in antigen processing 2; Really interesting new gene 11 protein; RING11; TAP2 ABCB3 PSF2 RING11 Y1
Species
Homo sapiens (Human)
Expression Region
430-686
Target Protein Sequence
YGDMLSNVGAAEKVFSYMDRQPNLPSPGTLAPTTLQGVVKFQDVSFAYPNRPDRPVLKGLTFTLRPGEVTALVGPNGSGKSTVAALLQNLYQPTGGQVLLDEKPISQYEHCYLHSQVVSVGQEPVLFSGSVRNNIAYGLQSCEDDKVMAAAQAAHADDFIQEMEHGIYTDVGEKGSQLAAGQKQRLAIARALVRDPRVLILDEATSALDVQCEQALQDWNSRGDRTVLVIAHRLQTVQRAHQILVLQEGKLQKLAQL
Protein Length
Partial
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
ABC transporter associated with antigen processing. In complex with TAP1 mediates unidirectional translocation of peptide antigens from cytosol to endoplasmic reticulum (ER) for loading onto MHC class I (MHCI) molecules. Uses the chemical energy of ATP to export peptides against the concentration gradient. During the transport cycle alternates between 'inward-facing' state with peptide binding site facing the cytosol to 'outward-facing' state with peptide binding site facing the ER lumen. Peptide antigen binding to ATP-loaded TAP1-TAP2 induces a switch to hydrolysis-competent 'outward-facing' conformation ready for peptide loading onto nascent MHCI molecules. Subsequently ATP hydrolysis resets the transporter to the 'inward facing' state for a new cycle. Typically transports intracellular peptide antigens of 8 to 13 amino acids that arise from cytosolic proteolysis via IFNG-induced immunoproteasome. Binds peptides with free N- and C-termini, the first three and the C-terminal residues being critical. Preferentially selects peptides having a highly hydrophobic residue at position 3 and hydrophobic or charged residues at the C-terminal anchor. Proline at position 2 has the most destabilizing effect. As a component of the peptide loading complex (PLC), acts as a molecular scaffold essential for peptide-MHCI assembly and antigen presentation.
Gene References into Functions
  1. Our findings support the hypothesis that hsa-miR-1270 suppresses the production of TAP2 by binding to this SNP in the 3'-UTR of this gene PMID: 29205500
  2. The present study illustrated that the carriage of LMP7 rs2071543-AA and TAP2 rs1800454-AA had a negative effect on treatment response to pegIFN-alpha/RBV among genotype 1 patient with chronic hepatitis C (CHC) in a Chinese Han population PMID: 29039469
  3. We replicated the association between the rs2071473 genotype and TAP2 expression by using GTEx data and demonstrated that TAP2 is expressed by decidual stromal cells at the maternal-fetal interface. PMID: 27745831
  4. Two eSNPs were associated with fecundability at a FDR of 5%; both were in the HLA region and were eQTLs for the TAP2 gene (P = 1.3x10-4) and the HLA-F gene (P = 4.0x10-4), respectively. PMID: 27447835
  5. These results suggest that TAP2 polymorphisms influence TB susceptibility in a Japanese population. PMID: 27325005
  6. Deletions of ABCB3 predict good tumor response to neoadjuvant chemotherapy in breast cancer. PMID: 26799285
  7. TAP/TPN complex formation is driven by hydrophobic interactions via leucine zipper-like motifs. PMID: 26519531
  8. TAP2, HLA-DOA, HLA-DOB, and tapasin loci are novel candidate regions for susceptibility to HCV infection and viral clearance in the Chinese population PMID: 25874709
  9. We showed that TAP2 gene has an association with pulmonary tuberculosis in Koreans. PMID: 25846714
  10. Our meta-analyses suggested that TAP2-379Ile allele was significantly associated with a 59% increased risk for rheumatoid arthritis PMID: 24972609
  11. Results suggested an association between TAP2-565 polymorphism and chronic lymphoid leukemia (CLL). TAP2-665 GG genotype might be a risk factor for CLL, chronic myeloblastic leukemia, and multiple myeloma. PMID: 24175803
  12. Three tapasin binding sites on TAP have been described, two of which are located in the N-terminal domains of TAP1 and TAP2. PMID: 24501197
  13. Although lung cancer cells bearing the preprocalcitonin ppCT(16-25) epitope display low levels of TAP, restoration of TAP expression inhibits ppCT antigen presentation. PMID: 23302073
  14. the N-terminal region of Snm1B forms a complex containing PSF2 and Mus81, while the C-terminal region is important for PSF2-mediated chromatin association. PMID: 23189151
  15. Genetic variation in TAP2 was associated with NHL risk overall, and follicular lymphoma risk in particular, and this was independent of other established loci from 6p21.3. PMID: 22911334
  16. the N-terminal extension of the TAP2 subunit represents an autonomous domain, which is correctly targeted to and inserted into the endoplasmic reticulum membrane PMID: 22638925
  17. Comparison of unpaired 50 primary breast cancer and 33 brain metastases showed lower expression of beta2-microglobulin, transporter associated with antigen processing (TAP) 1, TAP2 and calnexin in the brain lesions. PMID: 22065046
  18. Regression analysis revealed that polymorphisms and haplotypes of TAP2 were associated with FEV1 decline by aspirin provocation (P=0.002-0.04) in most of minor homozygotes compared with major homozygotes and AERD development. PMID: 21796142
  19. genetic polymorphism is associated with end stage renal disease in patients of North India PMID: 21440064
  20. Single cysteine residue within the antigen translocation complex TAP controls the epitope repertoire by stabilizing a receptive conformation. PMID: 20439763
  21. The higher frequency of HLA class I antigen and TAP down-regulation in metastases play a role in the clinical course of the disease. PMID: 20204276
  22. TAP-impaired HLA class I expression could influence the course of SCC originating in chronic ulcers and could be related to escape from cytotoxic T-lymphocyte surveillance during disease progression. PMID: 20083708
  23. Analysis of TAP2 polymorphisms in Finnish individuals with type I diabetes. PMID: 11916171
  24. There was a significant difference in the frequencies at position 665 of TAP 2 gene. TAP genes might have modifying effects on the cystic fibrosis phenotype. PMID: 12026214
  25. TAP2*Bky2 or its haplotype with DRB1*08032 may be involved in SS-A/Ro antibody production not only in SS but also SLE, indicating that TAP2*Bky2 may be a susceptible gene not only to the disease of SS but also to the SS-A/Ro autoantibody production. PMID: 12729048
  26. Expression of TAP2 is not identical to TAP1 in primary melanoma lesions. PMID: 12777979
  27. this allele is preferentially associated with the large conserved haplotype HLA DQA1*0501-DQB1*0201-DRB1*0301 and restricted to populations of African origin PMID: 12786999
  28. detected the presence of 17 nucleotide sequence variations in the entire coding region of TAP2 in an indigenous Zimbabwean population (Shona ethnic group) PMID: 12826376
  29. TAP2 gene polymorphism is not linked to renal cell carcinoma PMID: 12963978
  30. The results of this study provide genetic evidence that TAP2 gene codon 565 polymorphism may play a role in rheumatoid arthritis. PMID: 14749980
  31. Evidence is provided that that the extended haplotype of TAP2 is distinct in pauciarticular and polyarticular rheumatoid factor negative juvenile idiopathic arthritis patients. PMID: 15343265
  32. TAP1-2 gene polymorphisms may, by way of post-transcriptional changes and altered regulation of gene expression, be involve the immune system in the development of primary open-angle glaucoma PMID: 15887980
  33. Transmembrane segment 1 (TM1) of core-TAP2 is critical for its heterodimerization with core-TAP1. PMID: 16061226
  34. Results suggest the possible role of TAP2 gene polymorphism in the genetic susceptibility to systemic sclerosis . PMID: 16112028
  35. TAP variants lacking TAP2 N-terminal domain build peptide-loading complexes (PLC) that fail to generate stable MHC I-peptide complexes, which correlates with a substantially reduced recruitment of accessory chaperones into the PLC PMID: 16210614
  36. The TAP2-2 MspI polymorphism might be associated with calcium stone disease. PMID: 16215317
  37. Several TAP gene polymorphisms were examined and a TAP2 SNP (rs241448) associated with AD found in two independent case-control samples, especially in carriers of the APOE4 allele. PMID: 16595160
  38. Two Pemphigus vulgaris (PV) TAP2 risk alleles were identified (TAP2*C and TAP2*D) implying that TAP2 genes are involved in susceptibility to development of PV. PMID: 16690408
  39. These data reveal that the single-site polymorphism of the TAP2 gene at codon 665 may be an indicator for predicting Graves Disease development. PMID: 16721835
  40. The main active site required for peptide translocation by TAP1-TAP2 complexes resides at the TAP2 nucleotide binding site. PMID: 17068338
  41. Evidence of TAP2 association with type 1 diabetes that is independent of HLA DR-DQ may be based on allele dependence of splicing into isoforms known to have differential peptide selectivities. PMID: 17192492
  42. TAP2-651 site is associated with the risk of HBV infection PMID: 17525827
  43. First report on the role of TAP2 polymorphisms involved in the diverse pathogenesis of dengue virus infection. PMID: 18071882
  44. Allele 665 is associated with cervical cancer, but this is strongly influenced by linkage disequilibrium with human leukocyte antigen DQB1. PMID: 18650831
  45. Downregulation of TAP2 is associated with acute myeloid leukaemic blasts. PMID: 19148137

Show More

Hide All

Involvement in disease
Bare lymphocyte syndrome 1 (BLS1)
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Note=The transmembrane segments seem to form a pore in the membrane.
Protein Families
ABC transporter superfamily, ABCB family, MHC peptide exporter (TC 3.A.1.209) subfamily
Database Links

HGNC: 44

OMIM: 170261

KEGG: hsa:6891

STRING: 9606.ENSP00000364034

UniGene: Hs.502

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1