Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD), Partial

In Stock
Code CSB-EP890936HU2a0
Abbreviation Recombinant Human PYCARD protein, partial
MSDS
Size $306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
hASC;Caspase recruitment domain-containing protein 5;PYD and CARD domain-containing protein;Target of methylation-induced silencing 1
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
95-195aa
Target Protein Sequence
AAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
17.3 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human Apoptosis-associated speck-like protein containing a CARD (PYCARD) is produced in E. coli and spans the 95-195 amino acid region. This partial protein carries an N-terminal 6xHis-tag, which makes purification and detection more straightforward. The product shows a purity level exceeding 95%, as confirmed by SDS-PAGE analysis, making it suitable for various research applications. It is intended for research use only.

PYCARD, also known as ASC, serves as a crucial adaptor protein in inflammasome formation—multiprotein complexes that appear to play a key role in the innate immune response. Through its CARD and PYD domains, PYCARD mediates protein-protein interactions and helps activate caspase-1, which leads to the maturation of pro-inflammatory cytokines. Its role in inflammation has made it a significant focus in immunological research.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Based on the provided information, the recombinant human PYCARD fragment (95-195aa) is expressed in E. coli, a prokaryotic system that is generally suitable for producing small protein domains but may not support proper folding of eukaryotic protein interaction domains. This fragment contains the CARD domain of PYCARD, which requires precise folding for its role in inflammasome signaling. While E. coli can express soluble proteins, death-fold domains like CARD need specific conformational integrity for functional homotypic interactions. The protein has high purity (>95%) with an N-terminal 6xHis tag, but since activity is unverified and CARD domains require precise folding for caspase recruitment, the protein cannot be assumed to be correctly folded or bioactive without experimental validation.

1. Protein-Protein Interaction Studies Using Pull-Down Assays

The N-terminal 6xHis tag enables technical feasibility for pull-down assays. However, if the recombinant PYCARD protein is misfolded, it will not interact physiologically with true binding partners (e.g., caspase-1, other CARD domains). This application requires confirmation of proper folding through biophysical characterization before biological interpretation of results.

2. Antibody Development and Validation

The recombinant PYCARD fragment can serve as an effective immunogen for generating antibodies against linear epitopes within the 95-195aa region. The high purity supports immunization protocols. Validation against full-length PYCARD is recommended.

3. Biochemical Characterization and Biophysical Analysis

This application is well-suited for initial assessment. Techniques like circular dichroism spectroscopy and size-exclusion chromatography can evaluate the protein's folding state and oligomeric status. These studies are valuable for quality control of the recombinant PYCARD protein, not the native PYCARD.

4. In Vitro Reconstitution Studies

This application is high-risk without proper folding validation. If the recombinant PYCARD protein is misfolded, reconstitution studies will not reflect biological reality. This requires prior demonstration of proper folding and interaction capability.

Final Recommendation & Action Plan

Given that this is a single domain protein expressed in E. coli, recommend first performing: 1) Biophysical characterization (circular dichroism for secondary structure, analytical ultracentrifugation for oligomeric state) to assess folding quality; 2) Functional validation using known CARD-domain binding partners; 3) Comparison with full-length PYCARD if possible. Antibody development can proceed immediately. Avoid functional studies until proper folding is confirmed. Always include appropriate controls and validate findings with full-length protein when possible.

 

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Functions as key mediator in apoptosis and inflammation. Promotes caspase-mediated apoptosis involving predominantly caspase-8 and also caspase-9 in a probable cell type-specific manner. Involved in activation of the mitochondrial apoptotic pathway, promotes caspase-8-dependent proteolytic maturation of BID independently of FADD in certain cell types and also mediates mitochondrial translocation of BAX and activates BAX-dependent apoptosis coupled to activation of caspase-9, -2 and -3. Involved in macrophage pyroptosis, a caspase-1-dependent inflammatory form of cell death and is the major constituent of the ASC pyroptosome which forms upon potassium depletion and rapidly recruits and activates caspase-1. In innate immune response believed to act as an integral adapter in the assembly of the inflammasome which activates caspase-1 leading to processing and secretion of proinflammatory cytokines. The function as activating adapter in different types of inflammasomes is mediated by the pyrin and CARD domains and their homotypic interactions. Required for recruitment of caspase-1 to inflammasomes containing certain pattern recognition receptors, such as NLRP2, NLRP3, AIM2 and probably IFI16. In the NLRP1 and NLRC4 inflammasomes seems not be required but facilitates the processing of procaspase-1. In cooperation with NOD2 involved in an inflammasome activated by bacterial muramyl dipeptide leading to caspase-1 activation. May be involved in DDX58-triggered proinflammatory responses and inflammasome activation. Isoform 2 may have a regulating effect on the function as inflammasome adapter. Isoform 3 seems to inhibit inflammasome-mediated maturation of interleukin-1 beta. In collaboration with AIM2 which detects cytosolic double-stranded DNA may also be involved in a caspase-1-independent cell death that involves caspase-8. In adaptive immunity may be involved in maturation of dendritic cells to stimulate T-cell immunity and in cytoskeletal rearrangements coupled to chemotaxis and antigen uptake may be involved in post-transcriptional regulation of the guanine nucleotide exchange factor DOCK2; the latter function is proposed to involve the nuclear form. Also involved in transcriptional activation of cytokines and chemokines independent of the inflammasome; this function may involve AP-1, NF-kappa-B, MAPK and caspase-8 signaling pathways. For regulation of NF-kappa-B activating and inhibiting functions have been reported. Modulates NF-kappa-B induction at the level of the IKK complex by inhibiting kinase activity of CHUK and IKBK. Proposed to compete with RIPK2 for association with CASP1 thereby down-regulating CASP1-mediated RIPK2-dependent NF-kappa-B activation and activating interleukin-1 beta processing. Modulates host resistance to DNA virus infection, probably by inducing the cleavage of and inactivating CGAS in presence of cytoplasmic double-stranded DNA.
Gene References into Functions
  1. Cryo-EM structures of ASC and NLRC4 CARD filaments reveal a unified mechanism of nucleation and activation of caspase-1. PMID: 30279182
  2. ASC specks as a putative biomarker of pyroptosis in myelodysplastic syndromes PMID: 30072146
  3. results suggest that ASC, as a negative regulator of the MAVS-mediated innate immunity, may play an important role in host protection upon virus infection PMID: 29280086
  4. PYCARD gene and its transcript variant may play a critical and regulative role in the inflflammatory response of primary gout patients with different phases and Chinese medicine syndromes. PMID: 29086221
  5. ASC may be involved in tumor suppression and cell death via Bcl-2 and phosphor Src. PMID: 29459573
  6. Data show that in HK-2 cells and unilateral nephrectomy model, ASC expression level is significantly augmented after treatment with contrast media. Its silencing attenuates contrast-induced apoptosis in HK-2 cell. PMID: 27721494
  7. ASC specks released by microglia bind to amyloid-beta and increase amyloid-beta oligomer and aggregate formation, acting as an inflammation-driven cross-seed for amyloid-beta pathology PMID: 29293211
  8. ASC contributes to oral cavity squamous cell carcinoma metastasis, and high-level ASC expression is a marker for poor prognosis in OSCC patients PMID: 27367024
  9. ASC CpG methylation may prove to be a primary regulator of the pathogenesis of chronic inflammatory diseases such as heart failure. PMID: 26700661
  10. besides its role in the inhibition of the NF-kappaB pathway, NLRC3 interferes with the assembly and activity of the NALP3 inflammasome complex by competing with ASC for pro-caspase-1 binding PMID: 28584053
  11. ASC Induces Apoptosis via Activation of Caspase-9 by Enhancing Gap Junction-Mediated Intercellular Communication.( PMID: 28056049
  12. These data revealed that cross-linking of ASC(PYD) filaments via ASC(CARD) mediates the assembly of ASC foci. PMID: 27069117
  13. Down-regulation of mRNA expression was found in cases in which CASP8, TMS1 and DAPK were hypermethylated. PMID: 28361856
  14. loss of ASC driven tumor development is counterbalanced in the identical cell by the inhibition of pro-tumorigenic inflammation in the tumor cell itself PMID: 27768771
  15. the deubiquitinating enzyme USP50 binds to the ASC protein and subsequently regulates the inflammasome signaling pathway. PMID: 28094437
  16. ASC self-associates and binds NLRP3 PYD through equivalent protein regions, with higher binding affinity for the latter. These regions are located at opposite sides of the protein allowing multimeric complex formation previously shown in ASC PYD fibril assemblies. PMID: 27432880
  17. Our data identify RIPK3 and the ASC inflammasome as key tumor suppressors in AML. PMID: 27411587
  18. The role of the danger signals ASC and HMGB1 in the Fusobacterium nucleatum infection of gingival epithelial cells. PMID: 26687842
  19. Data show that NOD-like receptor signaling genes NOD2, PYCARD, CARD6, and IFI16 are upregulated in psoriatic epidermis. PMID: 26976200
  20. The methylated status of ASC/TMS1 promoter had the potential applicability for clinical evaluation the prognosis of gastric cancer PMID: 26260914
  21. it appears that ASC transcript expression may be a surrogate marker for depression and may represent a link between depression and the altered immune responses observed in these categories of individuals with elevated depressive symptoms. PMID: 26750863
  22. The proteins of NLRP3, ASC, and caspase-1 were observed in infiltrating inflammatory cells in cholesteatoma and chronic otitis media. PMID: 26457439
  23. ASC/TMS1 methylation was significantly correlated with higher tumor nuclear grade. ASC/TMS1 is a novel functional tumor suppressor in renal carcinogenesis. PMID: 26093088
  24. ASC Induces Procaspase-8 Death Effector Domain Filaments PMID: 26468282
  25. ASC interacts with NALP3 and caspase-1 via different domains. PMID: 25567507
  26. mRNA levels of Apoptosis-associated Speck-like protein were significantly higher in freshly isolated PBMCs from Chronic recurrent multifocal osteomyelitis patients in active disease than in healthy controls. PMID: 25061439
  27. The proteins (HSP90b, TSM1 and L-plastin) in the current study may hold potential in differentiating between melanoma and benign nevi in diagnostically challenging cases. PMID: 25191796
  28. caspase-1/ASC inflammasomes play a significant role in the activation of IL-1beta/ROS and NF-kappaB signaling of cytokine gene expression for T. cruzi control in human and mouse macrophages. PMID: 25372293
  29. Neutralization of ASC improves sperm motility in men with spinal cord injuries. PMID: 25205754
  30. Transcriptome analysis of human adipocytes implicates the NOD-like receptor pathway (NLRP3, PYCARD) in obesity-induced adipose inflammation. PMID: 25011057
  31. Data indicate that apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC) is highly expressed in medulloblastomas. PMID: 24469054
  32. R42W mutation had a significant effect on structure and increased stability. Although the R42W mutant exhibited reduced interaction with ASC PMID: 25006247
  33. ASC PYD prevented complex formation with NALP3 PYD in vitro PMID: 24585381
  34. Identify a novel innate immune signaling pathway (NLRP3-ASC-caspase-1-IL-1beta) activated by Ni(2+). PMID: 24158569
  35. this study was to investigate the mRNA levels of AIM2 and ASC in a lymphocyte cell line (Jurkat) before and after MiR-143 introducing. PMID: 23811549
  36. this study reports an interaction between promyelocytic leukemia protein and apoptosis-associated speck-like protein containing a caspase-activating recruitment domain (ASC). PMID: 24407287
  37. PYCARD methylation is associated with colon cancer. PMID: 24169962
  38. Activated AIM2 and NLRP3 nucleate PYD filaments of ASC, which, in turn, cluster the CARD of ASC. ASC thus nucleates CARD filaments of caspase-1, leading to proximity-induced activation.studies revealed a universal assembly process for ASC-dependent inflammasomes in both ALR and NLR families that involves nucleation-induced polymerization. PMID: 24630722
  39. Study shows that T. gondii-induced IL-1beta production is dependent on the classical inflammasome components caspase-1 and ASC.Additionally, a role for a specific parasite factor, dense granule protein GRA15, in T. gondii induction of IL-1beta was demonstrated. PMID: 23839215
  40. Reactivation of ASC protein expression in LS174T cells promotes sodium butyrate induced apoptosis. PMID: 23064206
  41. The findings of this work may suggest a crucial relationship between mutant MEFV/pyrin and remarkable ASC up-regulation in familial Mediterranean fever inflammation. PMID: 22934972
  42. These findings suggest stage-dependent dual roles of ASC in melanoma tumorigenesis. PMID: 22931929
  43. central role of CARDs in the formation of ASC signalling platforms PMID: 23110696
  44. ASC PYD can simultaneously self-associate and interact with NLRP3, rationalizing the model whereby ASC self-association upon recruitment to NLRP3 promotes clustering and activation of procaspase-1. PMID: 23066025
  45. ASC in different tissues may influence tumor growth in opposite directions. PMID: 23090995
  46. The study conclude that the frequency of TMS1/ASC gene methylation in cervical cancer is rare and have no any critical role in development of cervical cancer. PMID: 19258216
  47. Gene expression profiles of ASC or CatB deficient human DCs show marked overlap with downregulation of genes implicated in DC function. PMID: 22732093
  48. the requirement of TLR2/MyD88/NF-kappaB pathway (first signal) and ROS/potassium efflux (second signal) for NLRP3/ASC inflammasome formation, leading to caspase-1 activation and subsequent IL-1beta release during RSV infection PMID: 22295065
  49. Hypermethylation of ASC is associated with cholangiocarcinoma. PMID: 22230750
  50. Caspase-1 protein induces apoptosis-associated speck-like protein containing a caspase recruitment domain (ASC)-mediated necrosis independently of its catalytic activity. PMID: 21832064

Show More

Hide All

Subcellular Location
Cytoplasm. Inflammasome. Endoplasmic reticulum. Mitochondrion. Nucleus.; Golgi apparatus membrane.
Tissue Specificity
Widely expressed at low levels. Detected in peripheral blood leukocytes, lung, small intestine, spleen, thymus, colon and at lower levels in placenta, liver and kidney. Very low expression in skeletal muscle, heart and brain. Expressed in lung epithelial
Database Links

HGNC: 16608

OMIM: 606838

KEGG: hsa:29108

STRING: 9606.ENSP00000247470

UniGene: Hs.499094

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*