Home
Protein
Recombinant Proteins
Recombinant Human Arylacetamide deacetylase (AADAC), partial

Recombinant Human Arylacetamide deacetylase (AADAC), partial

^{In Stock}

Citations (1)

Code	CSB-EP001014HU
Abbreviation	Recombinant Human AADAC protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001014HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP001014HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) AADAC.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Citations
Related Products
Customer Reviews and Q&A
Target Background

Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

AADAC

Uniprot No.

P22760

Alternative Names

AAAD_HUMAN; Aada; Aadac; Arylacetamide deacetylase (esterase); Arylacetamide deacetylase; CES5A1; DAC

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

24-399aa

Target Protein Sequence

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

63.1kDa

Protein Length

partial

Tag Info

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

E.coli expressed Recombinant Human Arylacetamide deacetylase(AADAC) is a partial-length protein containing 376 amino acids. It carries a 10xHis-SUMO-tag at the N-terminus and a Myc-tag at the C-terminus. Its expression region is the 24-399aa of the human AADAC protein. The LC-MS/MS Analysis validated its identity and SDS-PAGE determined its purity. Its purity is greater than 90%. This protein is in-stock so that it will reach your lab bench faster. In addition to serving as an immunogen for antibody synthesis, the recombinant AADAC protein may also be used to investigate whether it is involved in the breakdown of certain drugs.

AADAC is a serine hydrolase that widely catalyzes the hydrolysis of some clinically used drugs. AADAC is primarily expressed in the human intestine and liver and is responsible for the hydrolysis of flutamide, phenacetin, and rifampicin. It is closely related to kidney failure and hepatotoxicity in some patients after taking flutamide or phenacetin.

Citations

Predominant contributions of carboxylesterase 1 and 2 in hydrolysis of anordrin in humans Jiang J.et al,Xenobiotica,2017

Customer Reviews and Q&A

■ Customer Reviews

Average Rating:

5.0 - 1 reviews

Submit a Review here

Applications : Drug related studies

Review: Hydrolytic rate in HIM was about 20% of value for HLM. They further observed that CES1 and CES2 were involved in anordrin hydrolysis, but not AADAC.

By Anonymous

Target Background

Function

Displays cellular triglyceride lipase activity in liver, increases the levels of intracellular fatty acids derived from the hydrolysis of newly formed triglyceride stores and plays a role in very low-density lipoprotein assembly. Displays serine esterase activity in liver. Deacetylates a variety of arylacetamide substrates, including xenobiotic compounds and procarcinogens, converting them to the primary arylamide compounds and increasing their toxicity.

Gene References into Functions

that the AADAC gene c.361+1G>A variant may be a potential candidate factor for Tourette syndrome development PMID: 29253601
Data suggest that AADAC in hepatocyte microsomes hydrolyzes ketoconazole, a synthetic imidazole antifungal agent, to N-deacetyl ketoconazole and thus triggers hepatocellular toxicity. PMID: 27422753
AADAC deletion is a candidate susceptibility factor for Gilles de la Tourette Syndrome PMID: 26444075
Translational N-glycosylation of AADAC plays a crucial role in regulating AADAC enzyme activity. PMID: 24125761
Lipolysis of cellular TG and VLDL production were impaired in HCV infected cells during the early peak of viral infection. This was partially explained by an apparent deficiency of a putative TG lipase, arylacetamide deacetylase (AADAC). PMID: 23542347
An AADAC*3 allele yields decreased enzyme activity in liver microsomes. PMID: 22415931
human AADAC was the enzyme responsible for the deacetylation of rifamycins and would affect the induction rate of drug-metabolizing enzymes by rifamycins and their induced hepatotoxicity. PMID: 21856291
Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator) PMID: 20379614
two intrinsic endoplasmic reticulum (ER) proteins, 11beta-hydroxysteroid dehydrogenase, isozyme 1 (11beta-HSD) and the 50-kDa esterase (E3), sharing some amino acid sequence motifs in their N-terminal transmembrane (TM) domains. PMID: 10318829