Recombinant Human Arylsulfatase B (ARSB)

In Stock
Code CSB-EP002142HUa0
Abbreviation Recombinant Human ARSB protein
MSDS
Size $224
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Activity
Not Test
Target Names
ARSB
Uniprot No.
Research Area
Cancer
Alternative Names
ASB;N-acetylgalactosamine-4-sulfatase;G4S
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
37-533aa
Target Protein Sequence
SGAGASRPPHLVFLLADDLGWNDVGFHGSRIRTPHLDALAAGGVLLDNYYTQPLCTPSRSQLLTGRYQIRTGLQHQIIWPCQPSCVPLDEKLLPQLLKEAGYTTHMVGKWHLGMYRKECLPTRRGFDTYFGYLLGSEDYYSHERCTLIDALNVTRCALDFRDGEEVATGYKNMYSTNIFTKRAIALITNHPPEKPLFLYLALQSVHEPLQVPEEYLKPYDFIQDKNRHHYAGMVSLMDEAVGNVTAALKSSGLWNNTVFIFSTDNGGQTLAGGNNWPLRGRKWSLWEGGVRGVGFVASPLLKQKGVKNRELIHISDWLPTLVKLARGHTNGTKPLDGFDVWKTISEGSPSPRIELLHNIDPNFVDSSPCPRNSMAPAKDDSSLPEYSAFNTSVHAAIRHGNWKLLTGYPGCGYWFPPPSQYNVSEIPSSDPPTKTLWLFDIDRDPEERHDLSREYPHIVTKLLSRLQFYHKHSVPVYFPAQDPRCDPKATGVWGPWM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
62.9 kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Removes sulfate groups from chondroitin-4-sulfate (C4S) and regulates its degradation. Involved in the regulation of cell adhesion, cell migration and invasion in colonic epithelium. In the central nervous system, is a regulator of neurite outgrowth and neuronal plasticity, acting through the control of sulfate glycosaminoglycans and neurocan levels.
Gene References into Functions
  1. Findings indicate that lower arylsulfatase B (ARSB) is associated with prostate cancer recurrence. PMID: 29081414
  2. Of the 20 patients included in the study, molecular genetic analysis was performed on 17 patients... molecular analysis results of four patients who was excluded from the overall study (three of which were another adult male siblings who did not receive ERT and one patient whose ERT duration was shorter than 6 months) were were included in determination of allele frequency of ARSB. PMID: 28884960
  3. Three novel mutations in ARSB were detected, expanding the mutational spectrum of ARSB causing MPS VI. A compound heterozygous for the c.464G>A (p.C155Y) and c.1163G>C (p.R388T) mutations, a 13.8-kb deletion encompassing exons 2 and 3, mutation c.479G>A (p.R160Q), and novel c.464G>A (p.C155Y) mutation. PMID: 27797586
  4. Mutation analysis of 19 Indian mucopolysaccharidosis VI patients revealed the presence of a total of 15 different mutations of which twelve were novel. PMID: 27826022
  5. Nine novel mutations of ARSB were identified in MPS VI cases from India in the present study. The study also provides some insights into the genotype-phenotype association in MPS VI PMID: 26609033
  6. Silencing Wnt9A increased the expression of CHST11 in the colonic epithelial cells, and chromatin immunoprecipitation assay demonstrated enhancing effects of Wnt9A siRNA and exogenous BMP4 on the CHST11 promoter PMID: 25511584
  7. Arylsulfatase B regulates versican expression by galectin-3 and AP-1 mediated transcriptional effects. PMID: 24240681
  8. Mutation analysis of the ARSB gene revealed seven missense and three frameshift mutations of which eight were novel. PMID: 24677745
  9. These studies reveal how carrageenan exposure can lead to transcriptional events in colonic epithelial cells through decline in arylsulfatase B activity, with subsequent impact on C4S, galectin-3, Sp1, and Wnt9A PMID: 24778176
  10. novel homozygous missense mutation, c.278 C>T, p.P93L, associated with mucopolysaccharidosis type VI PMID: 23855929
  11. ARSB activity was significantly higher in the normal tissues. PMID: 23835622
  12. PTC124 but not gentamicin, increases the level of ARSB activity. PMID: 22971959
  13. results indicate that mammalian ARSB improves functional recovery after CNS injury. PMID: 23520469
  14. Arylsulfatase B activity was significantly less in the polymorphonuclear leukocytes and mononuclear cells from the cystic fibrosis patients than controls. PMID: 22550062
  15. Sequencing analysis revealed a novel homozygous missense mutation in the ARSB gene at c.1457A PMID: 23023219
  16. investigation of substrate specificity of arylsulfatase B in colonic epithelial cells; competitive binding of complex polysaccharides/glycosaminoglycans with arylsulfatase B can affect generation of reactive oxygen species and inflammatory response PMID: 22079206
  17. Hypoxia reduces arylsulfatase B activity and silencing arylsulfatase B replicates and mediates the effects of hypoxia. PMID: 22428001
  18. 13 mucopolysaccharidosis type VI patients were found to be homozygous for the previously undescribed H178L ARSB mutation PMID: 21996138
  19. Altered ARSB immunostaining and reduced activity may be useful indicators of malignant transformation in human colonic tissue. PMID: 21378286
  20. Mucopolysaccharidosis type VI: Structural and clinical implications of mutations in N-acetylgalactosamine-4-sulfatase PMID: 11668612
  21. Seven novel mutation were identified in ARSB in mucopolysaccharidosis type VI patients undergoing a Clinical trial of enzyme replacement therapy, 3 of these mutations resulted in truncated proteins. PMID: 14974081
  22. analysis of novel mutations on the arylsulphatase B gene in South American Mucopolysaccharidosis type VI patients PMID: 16435196
  23. Decreased arylsulfatase B activity is associated with cystic fibrosis PMID: 17324393
  24. The identification of many novel mutations unique to individuals/their families highlighted the genetic heterogeneity of the mucopolysaccharidosis VI disorder. PMID: 17458871
  25. Novel mutations in arylsulfatase B is associated with mucopolysaccharidosis VI PMID: 17643332
  26. modification of expression of the lysosomal sulfatases ASB and GALNS regulates the content of CSs. PMID: 18285341
  27. Reduced activity of arylsulfatase B enzymatic activity in children with cystic fibrosis PMID: 18299243
  28. All the ARSB mutations studied had a significant effect on enzyme activity, protein processing and/or mRNA stability. PMID: 18406185
  29. arylsulfatase B gene mutation profile in Taiwanese MPS VI patients may be different from MPS VI patients from other countries[mucopolysaccharidosis type VI ] PMID: 18486607
  30. IL-8 increases in bronchial epithelial cells after arylsulfatase B silencing due to sequestration with chondroitin-4-sulfate PMID: 19346317

Show More

Hide All

Involvement in disease
Mucopolysaccharidosis 6 (MPS6); Multiple sulfatase deficiency (MSD)
Subcellular Location
Lysosome. Cell surface.
Protein Families
Sulfatase family
Database Links

HGNC: 714

OMIM: 253200

KEGG: hsa:411

STRING: 9606.ENSP00000264914

UniGene: Hs.149103

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*