Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN), partial

In Stock
Code CSB-EP896913HU
Abbreviation Recombinant Human CORIN protein, partial
MSDS
Size $256
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 85% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Cardiovascular
Alternative Names
(Corin)(Heart-specific serine proteinase ATC2)(Pro-ANP-converting enzyme)(Transmembrane protease serine 10)
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
1-110aa
Target Protein Sequence
MKQSPALAPEERCRRAGSPKPVLRADDNNMGNGCSQKLATANLLRFLLLVLIPCICALVLLLVILLSYVGTLQKVYFKSNGSEPLVTDGEIQGSDVILTNTIYNQSTVVS
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
16.0 kDa
Protein Length
Partial
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Serine-type endopeptidase involved in atrial natriuretic peptide (NPPA) and brain natriuretic peptide (NPPB) processing. Converts through proteolytic cleavage the non-functional propeptides NPPA and NPPB into their active hormones, ANP and BNP(1-32) respectively, thereby regulating blood pressure in the heart and promoting natriuresis, diuresis and vasodilation. Proteolytic cleavage of pro-NPPA also plays a role in female pregnancy by promoting trophoblast invasion and spiral artery remodeling in uterus. Also acts as a regulator of sodium reabsorption in kidney.; has weaker endopeptidase activity compared to isoform 1.
Gene References into Functions
  1. Data suggest that soluble corin lacking transmembrane domain is activated by PCSK6 in conditioned medium or in cell-free system but not intracellularly; cell membrane association is unnecessary for PCSK6 to activate corin; soluble corin and PCSK6 are secreted by cardiomyocytes (or HEK293 cells) via different intracellular pathways. (PCSK6 = proprotein convertase subtilisin/kexin type-6) PMID: 29180304
  2. Suggest that pro-ANP/corin/NPR-C signaling is dominant in the vascular system in preeclampsia. PMID: 29523263
  3. These results indicate that genetic variants impairing corin function are not uncommon in general populations and that such variants may be an important contributing factor in hypertension. PMID: 28861913
  4. Preeclampsia is one of the most severe complications of the pregnancy, and trials to estimate a panel of predictive markers are of big interest for multiple researches. Corin is a transmembrane serine protease, localized in the heart, which is converting pro-ANP in to active ANR. ANP is a hormone regulating salt hemostasis and arterial blood pressure. [review] PMID: 29370493
  5. Corin is a key enzyme in the natriuretic peptide system. The latest findings indicate that corin-mediated ANP production may act in a tissue-specific manner to regulate cardiovascular and renal function. Corin defects may contribute to major diseases such as hypertension, heart failure, pre-eclampsia, and kidney disease. PMID: 27898523
  6. association of 2 single nucleotide polymorphisms in CORIN (rs2271037 and rs3749585) with hypertension, as well as their potential interactions with some risk factors of hypertension in a Han population of northeastern China PMID: 29391274
  7. We detected elevated serum corin levels in women with pre-eclampsia. Interestingly, the serum corin levels were also found to be elevated in pregnancies with a related disorder, unexplained fetal growth restriction without hypertension, suggesting that this phenomenon is not simply a response to maternal hypertension. PMID: 27871468
  8. Corin and atrial natriuretic peptide A were most abundant in the proximal convoluted tubules and the medullary connecting ducts. PMID: 27343265
  9. CORIN expression is significantly downregulated in human masticatory mucosa during wound healing PMID: 28005267
  10. serum levels of corin are significantly decreased in acute myocardial infarction patients PMID: 26577631
  11. Data show that both furin and brain type natriuretic peptide (BNP) were more sensitive than corin in predicting cardiovascular complications in type 2 diabetes mellitus (T2DM) patients. PMID: 26488448
  12. Circulating corin concentrations are related to infarct size in patients after ST-segment elevation myocardial infarction PMID: 25981578
  13. Hypertensive participants had an increased serum corin level compared to those without hypertension, suggesting that corin may play a role in the pathology of hypertension. PMID: 25663063
  14. Serum soluble corin was significantly and positively associated with dyslipidemia PMID: 26344336
  15. Plasma corin levels decreased significantly from preoperative concentrations after coronary artery bypass graft surgery. PMID: 25649697
  16. corin may play an important role in the pathology of atrial fibrillation PMID: 26048191
  17. Increased serum soluble corin in mid pregnancy was associated with an increased risk for HDP(hypertensive disorders of pregnancy) .--increased serum soluble corin in mid pregnancy could be an indicator for HDP PMID: 26086065
  18. identified a PCSK6 mutation that impaired corin activation activity in a hypertensive patient PMID: 26259032
  19. the variant altered corin structure and impaired the natriuretic peptide processing activity in vivo. The results highlight corin defects as an important underlying mechanism in hypertension. PMID: 25488193
  20. IRE1-dependent corin mRNA decay is a mechanism leading to corin protein deficiency may contribute to the pathophysiology of impaired natriuretic peptide pro-hormone processing in humans processing in humans with advanced systolic heart failure. PMID: 25516437
  21. Serum soluble corin was decreased in patients with stroke compared with healthy controls. PMID: 26022632
  22. In conclusion, this is the first report of a highly significant association between these two single nucleotide polymorphisms in CORIN gene and preeclampsia. PMID: 25474356
  23. N-glycans at different sites may play distinct roles in regulating the cell membrane targeting, zymogen activation, and ectodomain shedding of corin PMID: 25451932
  24. data provide important insights into the molecular basis underlying corin mutations that may contribute to preeclampsia in patients. PMID: 24828501
  25. Corin mediates an essential step in the cascade of natriuretic peptide biosynthesis and eventually their action. Thus, it is postulated that aberrations in the normal activity of corin may contribute to cardiovascular and renal diseases. PMID: 24100222
  26. CORIN is expressed in non-pregnant late secretory phase endometrium, first trimester human implantation sites and is up-regulated with decidualization ex vivo PMID: 23434834
  27. The processing of proBNP1_108 by corin may be controlled by O-linked glycosylation of proBNP1-108. A potential impairment of proBNP1lo8 processing in heart failure may be linked to dysregulation of the convertase corin.[Review] PMID: 24015598
  28. human CORIN gene mutations causing impaired corin activity may be an underlying mechanism in hypertension PMID: 23372161
  29. The results indicate that renal tubular corin may be shed into urine and that urinary and renal corin levels were reduced in chronic kidney disease patients. PMID: 23327554
  30. Results indicate that corin defects may represent an important mechanism in salt-sensitive hypertension and cardiac hypertrophy in blacks. PMID: 22987923
  31. results indicate that corin and ANP are essential for physiological changes at the maternal-fetal interface, suggesting that defects in corin and ANP function may contribute to pre-eclampsia PMID: 22437503
  32. the function and regulation of corin PMID: 22093942
  33. the sequence in the cytoplasmic tail plays an important role in corin cell surface targeting and zymogen activation. PMID: 21518754
  34. Ectodomain shedding and autocleavage of the cardiac membrane protease corin. PMID: 21288900
  35. Data suggest that there may be patients for whom low corin levels and impaired pro-ANP cleavage contribute to acute decompensated heart failure. PMID: 21216831
  36. A modest correlation is demonstrated between plasma corin levels and individual echocardiographic indices of cardiac hypertrophy, but no relationships between plasma corin and myocardial performance are proved in this study. PMID: 20670840
  37. corin might be involved in the salt retention seen in glomerular diseases. PMID: 20613715
  38. Insufficient corin activation is expected to prevent natriuretic peptide processing and may contribute to body fluid retention and impaired cardiac function in patients with heart failure. PMID: 20802129
  39. Processing of pro-atrial natriuretic peptide by corin in cardiac myocytes. PMID: 11884416
  40. These data indicate that the GATA element and its binding to GATA-4 are essential for cardiac expression of the human and murine corin genes. PMID: 12154094
  41. the transmembrane domain is not necessary for the biological activity of corin but may be a mechanism to localize corin at specific sites PMID: 14559895
  42. in CORIN, the frizzled 1 domain and LDLR repeats 1-4 are important structural elements for recognition of the physiological substrate, pro-ANP PMID: 15192093
  43. The corin I555 (P568) allele is common in blacks and is associated with higher blood pressure and an increased risk for prevalent hypertension. PMID: 16216958
  44. Corin I555(P568) allele represents a cardiac hypertrophy-sensitizing genetic locus in systemic hypertension. PMID: 17296875
  45. N-linked oligosaccharides play an important role in corin activation PMID: 17660514
  46. ANP and corin are expressed at the mRNA level in human adipose tissue and preadipocytes PMID: 17890485
  47. corin gene single nucleotide polymorphism associated with hypertension and cardiac hypertrophy impair corin zymogen activation and natriuretic peptide processing activity PMID: 18669922
  48. Dysfunctional corin i555(p568) allele is associated with impaired brain natriuretic peptide processing and adverse outcomes in blacks with systolic heart failure: results from the Genetic Risk Assessment in Heart Failure substudy. PMID: 19919978

Show More

Hide All

Involvement in disease
Pre-eclampsia/eclampsia 5 (PEE5)
Subcellular Location
Cell membrane; Single-pass type II membrane protein. Note=May easily detached from the endothelial cell membrane.; [Isoform 2]: Cell membrane; Single-pass type II membrane protein. Note=Less efficiently targeted to the cell membrane compared to isoform 1.; [Atrial natriuretic peptide-converting enzyme, 180 kDa soluble fragment]: Secreted. Note=Soluble form produced following cleavage by ADAM10.; [Atrial natriuretic peptide-converting enzyme, 160 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.; [Atrial natriuretic peptide-converting enzyme, 100 kDa soluble fragment]: Secreted. Note=Soluble form produced following autocatalytic cleavage.
Protein Families
Peptidase S1 family
Tissue Specificity
Highly expressed in heart. Expressed in heart myocytes. Also expressed in pregnant uterus. Detected in blood, in plasma as well as in serum (at protein level).
Database Links

HGNC: 19012

OMIM: 605236

KEGG: hsa:10699

STRING: 9606.ENSP00000273857

UniGene: Hs.518618

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*